SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-6067
         (705 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

L10710-1|AAA27730.1|  382|Apis mellifera hyaluronidase protein.        23   3.7  
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    22   4.9  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    22   4.9  
AB238796-1|BAE93398.1|  128|Apis mellifera Queen brain-selective...    22   6.5  

>L10710-1|AAA27730.1|  382|Apis mellifera hyaluronidase protein.
          Length = 382

 Score = 22.6 bits (46), Expect = 3.7
 Identities = 7/36 (19%), Positives = 18/36 (50%)
 Frame = +1

Query: 10  PLLTVFMRKILVIPNVXQILTQFRIFWEIVYF*CEK 117
           P+  + +  +   P+  + + +F ++W +  F C K
Sbjct: 21  PINALLLGFVQSTPDNNKTVREFNVYWNVPTFMCHK 56


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
            AbsCAM-Ig7B protein.
          Length = 1923

 Score = 22.2 bits (45), Expect = 4.9
 Identities = 8/15 (53%), Positives = 11/15 (73%)
 Frame = -2

Query: 419  AVFVSWIPSLS*AGI 375
            A+F+SW+P L   GI
Sbjct: 1229 ALFISWLPPLEPNGI 1243


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
            AbsCAM-Ig7A protein.
          Length = 1919

 Score = 22.2 bits (45), Expect = 4.9
 Identities = 8/15 (53%), Positives = 11/15 (73%)
 Frame = -2

Query: 419  AVFVSWIPSLS*AGI 375
            A+F+SW+P L   GI
Sbjct: 1225 ALFISWLPPLEPNGI 1239


>AB238796-1|BAE93398.1|  128|Apis mellifera Queen brain-selective
           protein-1 protein.
          Length = 128

 Score = 21.8 bits (44), Expect = 6.5
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +2

Query: 206 CSKCKYGI 229
           C KCKYGI
Sbjct: 43  CHKCKYGI 50


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 190,908
Number of Sequences: 438
Number of extensions: 4600
Number of successful extensions: 7
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 21683070
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -