Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-5874
         (768 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

11_06_0147 - 20626854-20627181,20627267-20627377,20627461-206278...    28   9.4  

>11_06_0147 -
           20626854-20627181,20627267-20627377,20627461-20627846,
           20627949-20628057,20629375-20629421,20629506-20629646
          Length = 373

 Score = 27.9 bits (59), Expect = 9.4
 Identities = 19/71 (26%), Positives = 29/71 (40%)
 Frame = -3

Query: 349 VSCSSVTNRIHNESLPFMSRRFISIHERFSDFHSNTKQQNNSDLNYDITIGTFQKQNVNV 170
           VS SSV   + NES P  +   +S+H   ++ H     Q+   L YD           + 
Sbjct: 162 VSSSSVQGEVDNESSPVHTTGELSLH---ANTHEEAGNQSPGMLTYDADQDAVVSSGNST 218

Query: 169 KILN*TFFRNR 137
            + +  FF  R
Sbjct: 219 PVSSPRFFNRR 229


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,506,510
Number of Sequences: 37544
Number of extensions: 295213
Number of successful extensions: 406
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 400
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 406
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 2063219900
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)