Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-5821
         (305 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB253415-1|BAE86926.1|  588|Apis mellifera alpha-glucosidase pro...    20   6.0  
DQ855486-1|ABH88173.1|  104|Apis mellifera chemosensory protein ...    20   7.9  
DQ244074-1|ABB36784.1|  517|Apis mellifera cytochrome P450 monoo...    20   7.9  

>AB253415-1|BAE86926.1|  588|Apis mellifera alpha-glucosidase
           protein.
          Length = 588

 Score = 20.2 bits (40), Expect = 6.0
 Identities = 10/33 (30%), Positives = 17/33 (51%)
 Frame = -2

Query: 100 DEPAVQQQLHLL*LSETLHVLTYEEVLNYQFPK 2
           DEP + + L+L   +   H LT ++   Y+  K
Sbjct: 244 DEPPLGKNLNLSLHASLNHTLTKDQPETYELVK 276


>DQ855486-1|ABH88173.1|  104|Apis mellifera chemosensory protein 5
           protein.
          Length = 104

 Score = 19.8 bits (39), Expect = 7.9
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = -2

Query: 100 DEPAVQQQLHLL 65
           D P VQ+QLH +
Sbjct: 29  DRPYVQKQLHCI 40


>DQ244074-1|ABB36784.1|  517|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 517

 Score = 19.8 bits (39), Expect = 7.9
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = +3

Query: 267 RGARYPIRP 293
           R +RYP+RP
Sbjct: 119 RNSRYPLRP 127


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 57,005
Number of Sequences: 438
Number of extensions: 680
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 49
effective length of database: 124,881
effective search space used:  6493812
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 38 (20.3 bits)