Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-5685
         (771 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC004366-1|AAH04366.1|  221|Homo sapiens MGC10334 protein protein.     32   2.0  
AK128759-1|BAC87603.1|  140|Homo sapiens protein ( Homo sapiens ...    25   8.8  

>BC004366-1|AAH04366.1|  221|Homo sapiens MGC10334 protein protein.
          Length = 221

 Score = 32.3 bits (70), Expect = 2.0
 Identities = 18/55 (32%), Positives = 25/55 (45%)
 Frame = -3

Query: 550 YGTKYRGNRSPSADPEAPNDP*EWDYRQSERPSSVWSQMEEAGIWEPRPRDGSST 386
           +GT+  G   P A P+A   P     + ++ PSS W     +  W P PR G  T
Sbjct: 152 WGTEQEG-LDPVAQPKATRQP-----QPAQPPSSAWGLATGSSQWTPAPRGGRGT 200


>AK128759-1|BAC87603.1|  140|Homo sapiens protein ( Homo sapiens
           cDNA FLJ45035 fis, clone BRAWH3019594. ).
          Length = 140

 Score = 25.0 bits (52), Expect(2) = 8.8
 Identities = 10/13 (76%), Positives = 11/13 (84%)
 Frame = +3

Query: 249 CPVSESFGRQSQV 287
           CPVSE+FGR S V
Sbjct: 96  CPVSETFGRLSPV 108



 Score = 23.8 bits (49), Expect(2) = 8.8
 Identities = 11/18 (61%), Positives = 14/18 (77%)
 Frame = +3

Query: 222 DTWGRHFERCPVSESFGR 275
           +T+GR    CPVSE+FGR
Sbjct: 70  ETFGR---LCPVSETFGR 84


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 135,045,603
Number of Sequences: 237096
Number of extensions: 3488362
Number of successful extensions: 10010
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 9111
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10008
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 9311505506
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)