BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= ceN-5530
(593 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 30 0.020
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 3.9
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 3.9
>AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9
methyltransferase protein.
Length = 683
Score = 29.9 bits (64), Expect = 0.020
Identities = 11/31 (35%), Positives = 17/31 (54%)
Frame = +3
Query: 123 PFTVVPRVTGSIPTSDKHSCDEQICLLSVWV 215
P+TV + G+I HSCD + + VW+
Sbjct: 563 PYTVDAAIYGNISHFINHSCDPNLAVYGVWI 593
>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
AbsCAM-Ig7B protein.
Length = 1923
Score = 22.2 bits (45), Expect = 3.9
Identities = 7/11 (63%), Positives = 10/11 (90%)
Frame = +2
Query: 137 AEGHGFNSHIR 169
A GHGF++H+R
Sbjct: 18 AGGHGFDAHLR 28
>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
AbsCAM-Ig7A protein.
Length = 1919
Score = 22.2 bits (45), Expect = 3.9
Identities = 7/11 (63%), Positives = 10/11 (90%)
Frame = +2
Query: 137 AEGHGFNSHIR 169
A GHGF++H+R
Sbjct: 18 AGGHGFDAHLR 28
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 146,812
Number of Sequences: 438
Number of extensions: 2914
Number of successful extensions: 5
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 17359926
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -