SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-5196
         (359 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ067178-1|AAZ20250.1|  448|Apis mellifera conserved ATPase doma...    21   5.9  
AF205594-1|AAQ13840.1|  156|Apis mellifera acid phosphatase prec...    20   7.7  
AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul...    20   7.7  
AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A...    20   7.7  

>DQ067178-1|AAZ20250.1|  448|Apis mellifera conserved ATPase
          domain protein protein.
          Length = 448

 Score = 20.6 bits (41), Expect = 5.9
 Identities = 9/20 (45%), Positives = 12/20 (60%)
 Frame = -3

Query: 75 FSITALGESVR*SCRELRNI 16
          FS+  LG     S +ELRN+
Sbjct: 1  FSLGGLGSGFANSVKELRNL 20


>AF205594-1|AAQ13840.1|  156|Apis mellifera acid phosphatase
           precursor protein.
          Length = 156

 Score = 20.2 bits (40), Expect = 7.7
 Identities = 9/32 (28%), Positives = 19/32 (59%)
 Frame = +3

Query: 126 MFLLYVSTYAPVSMKKITAGNIEIVQRLLRYE 221
           +F   ++   P+ +KK+  GN  I+  L+R++
Sbjct: 112 VFTYNITNSTPL-LKKLYGGNSTIIFLLIRFK 142


>AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule
            AbsCAM-Ig7B protein.
          Length = 1923

 Score = 20.2 bits (40), Expect = 7.7
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = -3

Query: 330  KFLLCDNTYDL 298
            K LLC NTY L
Sbjct: 1463 KGLLCGNTYQL 1473


>AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member
            AbsCAM-Ig7A protein.
          Length = 1919

 Score = 20.2 bits (40), Expect = 7.7
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = -3

Query: 330  KFLLCDNTYDL 298
            K LLC NTY L
Sbjct: 1459 KGLLCGNTYQL 1469


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 100,464
Number of Sequences: 438
Number of extensions: 1827
Number of successful extensions: 6
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 51
effective length of database: 124,005
effective search space used:  8432340
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)

- SilkBase 1999-2023 -