BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= ceN-4938
(443 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
04_04_0236 + 23825368-23825763,23826229-23828667 29 2.2
>04_04_0236 + 23825368-23825763,23826229-23828667
Length = 944
Score = 28.7 bits (61), Expect = 2.2
Identities = 13/47 (27%), Positives = 27/47 (57%)
Frame = +2
Query: 65 KLMDFLMSFNDILNYQVTYIVFISKTNINYYCFSCKGKP*GKKLSFV 205
+++ F+M F D+ ++Q + F +KT +N S +G+P + F+
Sbjct: 282 EMVRFMMCFKDLPDWQREHRPFNAKTRLNPKIHSGRGRPPNQNKDFM 328
Database: rice
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,855,694
Number of Sequences: 37544
Number of extensions: 115162
Number of successful extensions: 150
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 150
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 150
length of database: 14,793,348
effective HSP length: 76
effective length of database: 11,940,004
effective search space used: 847740284
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -