BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= ceN-4105
(448 letters)
Database: fruitfly
53,049 sequences; 24,988,368 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AE014297-1196|AAF54554.2| 614|Drosophila melanogaster CG6547-PA... 32 0.30
>AE014297-1196|AAF54554.2| 614|Drosophila melanogaster CG6547-PA
protein.
Length = 614
Score = 32.3 bits (70), Expect = 0.30
Identities = 13/31 (41%), Positives = 19/31 (61%)
Frame = +1
Query: 340 STLRCSHVLNLFTLFSYERIKNSRGGPVPNS 432
S + CSH +FT+F+ ++KNS G V S
Sbjct: 272 SDITCSHPHTIFTVFNKHQVKNSHGSEVTTS 302
Database: fruitfly
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 24,988,368
Number of sequences in database: 53,049
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,572,035
Number of Sequences: 53049
Number of extensions: 313106
Number of successful extensions: 440
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 440
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 440
length of database: 24,988,368
effective HSP length: 79
effective length of database: 20,797,497
effective search space used: 1435027293
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -