SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-4080
         (567 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             23   1.6  
AY569716-1|AAS86669.1|  406|Apis mellifera complementary sex det...    22   3.7  
AY569707-1|AAS86660.1|  408|Apis mellifera complementary sex det...    21   6.5  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              21   8.6  

>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 23.4 bits (48), Expect = 1.6
 Identities = 12/33 (36%), Positives = 15/33 (45%)
 Frame = -1

Query: 111 VCKRCGVGDGRHESAIYGRQHAGQHHQLHHSVS 13
           V +R    D R   ++ G Q    H QLHH  S
Sbjct: 787 VMRRLMSEDKRLSKSVNGDQSQPPHQQLHHHQS 819


>AY569716-1|AAS86669.1|  406|Apis mellifera complementary sex
           determiner protein.
          Length = 406

 Score = 22.2 bits (45), Expect = 3.7
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = -3

Query: 79  PRVRHIRPPT 50
           PR RHI PPT
Sbjct: 371 PRFRHIGPPT 380


>AY569707-1|AAS86660.1|  408|Apis mellifera complementary sex
           determiner protein.
          Length = 408

 Score = 21.4 bits (43), Expect = 6.5
 Identities = 10/18 (55%), Positives = 12/18 (66%), Gaps = 2/18 (11%)
 Frame = -3

Query: 79  PRVRHIRPPTC--RTTPP 32
           PR+R+I PPT   R  PP
Sbjct: 373 PRLRYIGPPTSFPRFIPP 390


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 21.0 bits (42), Expect = 8.6
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = -1

Query: 381 SEGSAVGDVSG 349
           ++GSAVGDV G
Sbjct: 40  ADGSAVGDVPG 50


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 135,985
Number of Sequences: 438
Number of extensions: 2232
Number of successful extensions: 6
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 16440594
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -