Bombyx BLAST Result against fruitfly

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-3984
         (482 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014298-2906|AAF48996.2| 2111|Drosophila melanogaster CG14215-P...    28   7.7  

>AE014298-2906|AAF48996.2| 2111|Drosophila melanogaster CG14215-PA
           protein.
          Length = 2111

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 2/70 (2%)
 Frame = -2

Query: 244 RNRQ--GGGTYPCGLTRGPTTSNYANYNFAGLIFITRCYSFTVEVNREQLLYVFH*KNWY 71
           RNRQ   GG   C +    T S ++     G + I    S+    +++  L +F    WY
Sbjct: 360 RNRQILDGGI--CSVIGCATASTFSFAGDNGTLLIV--ISWHSSADKKNKLVLFDINQWY 415

Query: 70  PPEIRTSVHR 41
             E+ TSVH+
Sbjct: 416 KDEMPTSVHK 425


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,300,215
Number of Sequences: 53049
Number of extensions: 558425
Number of successful extensions: 1050
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1006
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1050
length of database: 24,988,368
effective HSP length: 79
effective length of database: 20,797,497
effective search space used: 1684597257
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)