BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= ceN-2474
(612 letters)
Database: fruitfly
53,049 sequences; 24,988,368 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AE014134-1389|AAF52597.3| 2898|Drosophila melanogaster CG7466-PA... 31 1.2
>AE014134-1389|AAF52597.3| 2898|Drosophila melanogaster CG7466-PA
protein.
Length = 2898
Score = 31.1 bits (67), Expect = 1.2
Identities = 12/41 (29%), Positives = 22/41 (53%), Gaps = 3/41 (7%)
Frame = +2
Query: 167 THKRVKKLVHPKNVCLMWESKPWRYSQYL---YCTTESVKS 280
TH V K+ P ++C +W + ++ Y+ YCT ++ S
Sbjct: 1903 THSHVTKITLPDDICQLWSNGKYQCRHYMGCSYCTIQNTYS 1943
Database: fruitfly
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 24,988,368
Number of sequences in database: 53,049
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 27,750,920
Number of Sequences: 53049
Number of extensions: 597811
Number of successful extensions: 1312
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1256
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1312
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2497240350
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -