Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-2140
         (668 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY920544-1|AAX62142.1|  463|Tribolium castaneum cytochrome P450 ...    25   0.56 
AY884062-1|AAX84203.1|  712|Tribolium castaneum laccase 2B protein.    22   5.2  
AY884061-1|AAX84202.1|  717|Tribolium castaneum laccase 2A protein.    21   6.9  

>AY920544-1|AAX62142.1|  463|Tribolium castaneum cytochrome P450
           monooxygenase protein.
          Length = 463

 Score = 25.0 bits (52), Expect = 0.56
 Identities = 11/38 (28%), Positives = 21/38 (55%)
 Frame = +1

Query: 211 LVQPDGVHRIVEYTSDKVNGFNANVRYEGHPVAQPAKI 324
           +V+PD +H ++E    K+   N+N   EG    + ++I
Sbjct: 218 IVRPDLIHLLMEARKGKLKHDNSNEGGEGFATVEESEI 255


>AY884062-1|AAX84203.1|  712|Tribolium castaneum laccase 2B protein.
          Length = 712

 Score = 21.8 bits (44), Expect = 5.2
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +3

Query: 525 NPSNLLFPCHFL 560
           NP   LF CHFL
Sbjct: 663 NPGYWLFHCHFL 674


>AY884061-1|AAX84202.1|  717|Tribolium castaneum laccase 2A protein.
          Length = 717

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +3

Query: 525 NPSNLLFPCHFL 560
           NP   LF CHFL
Sbjct: 663 NPGFWLFHCHFL 674


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 104,772
Number of Sequences: 336
Number of extensions: 1824
Number of successful extensions: 4
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 17385535
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)