Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-2053
         (777 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U89800-1|AAD03793.1|  260|Anopheles gambiae Tc1-like transposase...    27   0.86 
AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.            24   6.0  

>U89800-1|AAD03793.1|  260|Anopheles gambiae Tc1-like transposase
           protein.
          Length = 260

 Score = 26.6 bits (56), Expect = 0.86
 Identities = 14/50 (28%), Positives = 23/50 (46%), Gaps = 1/50 (2%)
 Frame = +2

Query: 605 CAIFL*-LDLRQSVFFVHKTRHVRAICQRMQKSNHRIAPRGSRARVEYFE 751
           CA++   LDL+ S   V +  H    C R  +   ++ P    AR+ + E
Sbjct: 6   CALYKQELDLQVSAKTVSRRLHAAGFCARRPRKVRKLLPHHVEARIRFAE 55


>AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.
          Length = 3398

 Score = 23.8 bits (49), Expect = 6.0
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = +1

Query: 268  FRYFCATSSSNKC 306
            F  FC+T SSN C
Sbjct: 1622 FNLFCSTGSSNSC 1634


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 845,095
Number of Sequences: 2352
Number of extensions: 17663
Number of successful extensions: 33
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 32
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 33
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 81081585
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)