SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-1693
         (647 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M29492-1|AAA27727.1|   74|Apis mellifera protein ( Bee homeobox-...    22   5.9  
AF144379-1|AAD34586.1|  543|Apis mellifera glutamate transporter...    22   5.9  
AY331183-1|AAP94623.1|  953|Apis mellifera NMDA-type glutamate r...    21   7.8  
AF388659-2|AAK71994.1|  463|Apis mellifera 1D-myo-inositol-trisp...    21   7.8  

>M29492-1|AAA27727.1|   74|Apis mellifera protein ( Bee
           homeobox-containing gene,partial cds, clone H40. ).
          Length = 74

 Score = 21.8 bits (44), Expect = 5.9
 Identities = 10/21 (47%), Positives = 13/21 (61%)
 Frame = -1

Query: 512 VTMTQVIQWVQNPRTVTEAKN 450
           +T TQV  W QN RT  + +N
Sbjct: 47  LTETQVKIWFQNRRTKWKKQN 67


>AF144379-1|AAD34586.1|  543|Apis mellifera glutamate transporter
           Am-EAAT protein.
          Length = 543

 Score = 21.8 bits (44), Expect = 5.9
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = +2

Query: 176 ALVTLPTIMYF 208
           AL+TLPTI +F
Sbjct: 327 ALITLPTIFWF 337


>AY331183-1|AAP94623.1|  953|Apis mellifera NMDA-type glutamate
           receptor 1 protein.
          Length = 953

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = +2

Query: 203 YFEQLLHQININ 238
           YFEQ L+++N N
Sbjct: 48  YFEQTLNELNFN 59


>AF388659-2|AAK71994.1|  463|Apis mellifera
           1D-myo-inositol-trisphosphate 3-kinaseisoform B protein.
          Length = 463

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 15/52 (28%), Positives = 20/52 (38%)
 Frame = -3

Query: 552 DRRDPSKPQRRLLRYHDTSDPMGTKPTYRD*SQELRAVERKVLRRRKPCMLG 397
           D R   K +  LLR  D+ D   +  TY        A    V  +   C+LG
Sbjct: 63  DGRVGGKRRNILLRRTDSMDSQNSASTYNSFLSSDSASSGNVYCKCDDCLLG 114


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 186,528
Number of Sequences: 438
Number of extensions: 4164
Number of successful extensions: 7
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19560480
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -