SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-1648
         (737 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellif...    23   2.3  
EF540769-1|ABQ14707.1|  620|Apis mellifera adenosine deaminase p...    23   3.0  
AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.          22   6.9  
U70841-1|AAC47455.1|  377|Apis mellifera ultraviolet sensitive o...    21   9.1  
AF004168-1|AAC13417.1|  377|Apis mellifera blue-sensitive opsin ...    21   9.1  

>AJ968562-1|CAI91546.1|  998|Apis mellifera protein ( Apis mellifera
           ORF for hypotheticalprotein. ).
          Length = 998

 Score = 23.4 bits (48), Expect = 2.3
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = +2

Query: 38  RASWISARCQQVGEASAFLQRRSPRAYF 121
           R S+ SA+ +++  AS+  QRR    YF
Sbjct: 24  RTSFSSAKLEKLYRASSLQQRRGGLEYF 51


>EF540769-1|ABQ14707.1|  620|Apis mellifera adenosine deaminase
           protein.
          Length = 620

 Score = 23.0 bits (47), Expect = 3.0
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -2

Query: 232 NACNTIIQEPKNT 194
           NA  T+ QEPKNT
Sbjct: 136 NAFKTLTQEPKNT 148


>AF084556-1|AAC71015.1|  652|Apis mellifera pipsqueak protein.
          Length = 652

 Score = 21.8 bits (44), Expect = 6.9
 Identities = 16/40 (40%), Positives = 19/40 (47%), Gaps = 2/40 (5%)
 Frame = -3

Query: 138 PVNAYSKYAR--GDRL*RNALASPTCWHRAEIHDALNPDR 25
           P +   K AR  G RL     ASPT W  A++  AL   R
Sbjct: 494 PSSTLYKIARREGIRLAAPFNASPTTWSPADLDRALEAIR 533


>U70841-1|AAC47455.1|  377|Apis mellifera ultraviolet sensitive
           opsin protein.
          Length = 377

 Score = 21.4 bits (43), Expect = 9.1
 Identities = 5/10 (50%), Positives = 8/10 (80%)
 Frame = -3

Query: 678 VRCVYVWTYV 649
           V C+++W YV
Sbjct: 221 VTCIFIWAYV 230


>AF004168-1|AAC13417.1|  377|Apis mellifera blue-sensitive opsin
           protein.
          Length = 377

 Score = 21.4 bits (43), Expect = 9.1
 Identities = 5/10 (50%), Positives = 8/10 (80%)
 Frame = -3

Query: 678 VRCVYVWTYV 649
           V C+++W YV
Sbjct: 221 VTCIFIWAYV 230


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 212,749
Number of Sequences: 438
Number of extensions: 4757
Number of successful extensions: 11
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 23023035
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -