Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-1578
         (456 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_06_0746 - 31636024-31641396                                         27   9.5  

>01_06_0746 - 31636024-31641396
          Length = 1790

 Score = 26.6 bits (56), Expect = 9.5
 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 3/61 (4%)
 Frame = +1

Query: 193 VRVIVSLIDLVKIYNNILGVR---KPHPKPKNWYLQSCKFWEARYQRRARAFVDPEHQLF 363
           +RV+  + +++K  N +   R   KPH   +N+   +  FW  R  +R R  +DP    F
Sbjct: 237 IRVVTPIYNVLK--NEVEASRNGTKPHSAWRNYDDVNEYFWSRRVFKRLRWPLDPSRSFF 294

Query: 364 L 366
           +
Sbjct: 295 V 295


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,024,296
Number of Sequences: 37544
Number of extensions: 220730
Number of successful extensions: 492
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 489
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 492
length of database: 14,793,348
effective HSP length: 76
effective length of database: 11,940,004
effective search space used: 895500300
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)