SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-1489
         (313 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK098761-1|BAC05406.1|  137|Homo sapiens protein ( Homo sapiens ...    30   1.7  

>AK098761-1|BAC05406.1|  137|Homo sapiens protein ( Homo sapiens
           cDNA FLJ25895 fis, clone CBR03553. ).
          Length = 137

 Score = 29.9 bits (64), Expect = 1.7
 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 4/67 (5%)
 Frame = -2

Query: 303 FSV*YRKXVIDVYGLR*PLNTWWAVSSSIYLSSWMSTPK---MRCNTKTTFFFLFVKCLN 133
           +SV + K  +   G    ++T W    S Y +SW+  PK     CN  +TF F  +   N
Sbjct: 68  YSVQFSKSFVCRTGSHLYIHTLWGKPRSSYTASWVYFPKHFLPPCNLPSTFCFPQLPLFN 127

Query: 132 AI-MQLL 115
            + M+LL
Sbjct: 128 LVAMKLL 134


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 33,910,763
Number of Sequences: 237096
Number of extensions: 618021
Number of successful extensions: 1030
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1022
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1030
length of database: 76,859,062
effective HSP length: 78
effective length of database: 58,365,574
effective search space used: 1459139350
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -