BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= ceN-1489
(313 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AK098761-1|BAC05406.1| 137|Homo sapiens protein ( Homo sapiens ... 30 1.7
>AK098761-1|BAC05406.1| 137|Homo sapiens protein ( Homo sapiens
cDNA FLJ25895 fis, clone CBR03553. ).
Length = 137
Score = 29.9 bits (64), Expect = 1.7
Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 4/67 (5%)
Frame = -2
Query: 303 FSV*YRKXVIDVYGLR*PLNTWWAVSSSIYLSSWMSTPK---MRCNTKTTFFFLFVKCLN 133
+SV + K + G ++T W S Y +SW+ PK CN +TF F + N
Sbjct: 68 YSVQFSKSFVCRTGSHLYIHTLWGKPRSSYTASWVYFPKHFLPPCNLPSTFCFPQLPLFN 127
Query: 132 AI-MQLL 115
+ M+LL
Sbjct: 128 LVAMKLL 134
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 33,910,763
Number of Sequences: 237096
Number of extensions: 618021
Number of successful extensions: 1030
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1022
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1030
length of database: 76,859,062
effective HSP length: 78
effective length of database: 58,365,574
effective search space used: 1459139350
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -