BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= ceN-1405
(615 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase ... 26 1.1
AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding pr... 24 4.5
AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding pr... 24 4.5
>AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase
protein.
Length = 849
Score = 25.8 bits (54), Expect = 1.1
Identities = 14/45 (31%), Positives = 25/45 (55%)
Frame = -2
Query: 281 KLKLNLTMDLLANIGLLRRTNLRRELYTWRFKYIKNRALFHF*NL 147
++ LN T D A + ++ +EL++WR K +A++H NL
Sbjct: 272 RMVLNQTQDHRAIV----LASVAKELFSWRIMVKKMKAIYHTLNL 312
>AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding
protein AgamOBP34 protein.
Length = 311
Score = 23.8 bits (49), Expect = 4.5
Identities = 7/13 (53%), Positives = 11/13 (84%)
Frame = -3
Query: 499 CLLYNIFTCDNDV 461
CL N++TCD+D+
Sbjct: 123 CLAENLYTCDDDL 135
>AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding
protein AgamOBP37 protein.
Length = 311
Score = 23.8 bits (49), Expect = 4.5
Identities = 7/13 (53%), Positives = 11/13 (84%)
Frame = -3
Query: 499 CLLYNIFTCDNDV 461
CL N++TCD+D+
Sbjct: 123 CLAENLYTCDDDL 135
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 549,725
Number of Sequences: 2352
Number of extensions: 10098
Number of successful extensions: 10
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 60132501
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -