Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-1388
         (427 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X16709-1|CAA34681.1|  162|Apis mellifera phospholipase A-2 protein.    21   5.8  
EF373554-1|ABQ28728.1|  167|Apis mellifera phospholipase A2 prot...    21   5.8  
AF438408-1|AAL30844.1|  167|Apis mellifera phospholipase A2 prot...    21   5.8  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              21   7.6  

>X16709-1|CAA34681.1|  162|Apis mellifera phospholipase A-2 protein.
          Length = 162

 Score = 21.0 bits (42), Expect = 5.8
 Identities = 6/12 (50%), Positives = 9/12 (75%)
 Frame = -2

Query: 330 CSCNSKFFDRLR 295
           C C+ KF+D L+
Sbjct: 89  CDCDDKFYDCLK 100


>EF373554-1|ABQ28728.1|  167|Apis mellifera phospholipase A2
           protein.
          Length = 167

 Score = 21.0 bits (42), Expect = 5.8
 Identities = 6/12 (50%), Positives = 9/12 (75%)
 Frame = -2

Query: 330 CSCNSKFFDRLR 295
           C C+ KF+D L+
Sbjct: 94  CDCDDKFYDCLK 105


>AF438408-1|AAL30844.1|  167|Apis mellifera phospholipase A2
           protein.
          Length = 167

 Score = 21.0 bits (42), Expect = 5.8
 Identities = 6/12 (50%), Positives = 9/12 (75%)
 Frame = -2

Query: 330 CSCNSKFFDRLR 295
           C C+ KF+D L+
Sbjct: 94  CDCDDKFYDCLK 105


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 20.6 bits (41), Expect = 7.6
 Identities = 9/31 (29%), Positives = 18/31 (58%)
 Frame = -2

Query: 306  DRLR*GSINVIITTHSTY*RELNLVNDNNVC 214
            DR++ G++   I +HST+    ++  + N C
Sbjct: 1665 DRIKRGTVIRSIRSHSTWDPRRHMYEELNHC 1695


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 115,518
Number of Sequences: 438
Number of extensions: 2160
Number of successful extensions: 5
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 52
effective length of database: 123,567
effective search space used: 10997463
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)