BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= ceN-1233
(787 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 26 1.1
>AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase
protein.
Length = 1099
Score = 26.2 bits (55), Expect = 1.1
Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 6/65 (9%)
Frame = +2
Query: 80 RTLDVRSGRMKL-SSYVRD----FRTPEASRFQSVNEGAL*AQMLGPERW*TM-PGQVEV 241
RT V +G ++ SY +D + T E +SV G +LGP W TM G +++
Sbjct: 588 RTKRVPAGLQRIIHSYFQDRELVYETSEGPVVRSVTAGVPQGSILGPTLWNTMYDGVLDI 647
Query: 242 RGNPD 256
PD
Sbjct: 648 ALPPD 652
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 840,295
Number of Sequences: 2352
Number of extensions: 17687
Number of successful extensions: 82
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 81
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 82
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 82328994
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -