BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= ceN-1179
(309 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AK123924-1|BAC85726.1| 142|Homo sapiens protein ( Homo sapiens ... 27 8.5
>AK123924-1|BAC85726.1| 142|Homo sapiens protein ( Homo sapiens
cDNA FLJ41930 fis, clone PERIC2004379. ).
Length = 142
Score = 27.5 bits (58), Expect = 8.5
Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 2/30 (6%)
Frame = +2
Query: 14 TSVQPTSAAS*DQCSWPPVWWLYW--PSLT 97
T++ S +S Q WPP W L++ P+LT
Sbjct: 97 TAILQGSTSSPAQACWPPAWMLFFTGPALT 126
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 32,501,872
Number of Sequences: 237096
Number of extensions: 495997
Number of successful extensions: 1082
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1066
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1082
length of database: 76,859,062
effective HSP length: 78
effective length of database: 58,365,574
effective search space used: 1400773776
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -