Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-1171
         (780 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_04_0297 - 24219497-24219853,24221242-24222414                       30   1.8  

>04_04_0297 - 24219497-24219853,24221242-24222414
          Length = 509

 Score = 30.3 bits (65), Expect = 1.8
 Identities = 21/62 (33%), Positives = 29/62 (46%), Gaps = 4/62 (6%)
 Frame = +3

Query: 570 GRNRQGGGTY--PCGLTIGPTTSGNVN*TSNQFYPRCSYGDIPMGIP--ILI*KKKLCYQ 737
           G  R G G Y  P GLT  P  +G V   SN+  P  ++ D+P      + + K  LC  
Sbjct: 43  GNKRSGNGDYVVPAGLTPNPMMNGTVVYHSNE--PLPAFKDVPASEKQNLFVKKVNLCCA 100

Query: 738 MY 743
           +Y
Sbjct: 101 VY 102


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,490,833
Number of Sequences: 37544
Number of extensions: 389265
Number of successful extensions: 685
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 676
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 683
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2091906552
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)