Bombyx BLAST Result against fruitfly

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-1125
         (761 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014298-2300|AAF48549.2|  418|Drosophila melanogaster CG12697-P...    31   1.7  

>AE014298-2300|AAF48549.2|  418|Drosophila melanogaster CG12697-PA
           protein.
          Length = 418

 Score = 31.1 bits (67), Expect = 1.7
 Identities = 13/47 (27%), Positives = 24/47 (51%)
 Frame = -3

Query: 705 LINNFKKCFLCCKNNYGVFFGVIRYVKTLLFERKEKK*RNLIKTFGF 565
           L+NN     +  +N    F GV+ +V+ +     ++K R LI+ F +
Sbjct: 66  LLNNLSDIIITTENCCTTFMGVLNFVRLIHLRLNQRKFRQLIENFSY 112


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,815,376
Number of Sequences: 53049
Number of extensions: 446938
Number of successful extensions: 961
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 941
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 961
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3499501170
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)