BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1112 (705 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16492| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_54752| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_20783| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_51257| Best HMM Match : Pox_F16 (HMM E-Value=4.1) 40 0.003 SB_58989| Best HMM Match : RVT_1 (HMM E-Value=0) 39 0.003 SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_31373| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) 37 0.014 SB_40765| Best HMM Match : DX (HMM E-Value=1.4) 37 0.014 SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) 37 0.014 SB_43828| Best HMM Match : XPG_N (HMM E-Value=1.8) 37 0.018 SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) 37 0.018 SB_4935| Best HMM Match : Pox_F16 (HMM E-Value=5.3) 37 0.018 SB_33076| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) 37 0.018 SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) 37 0.018 SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) 36 0.024 SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) 36 0.024 SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_7946| Best HMM Match : DUF434 (HMM E-Value=7.5) 36 0.032 SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23) 36 0.032 SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1) 36 0.042 SB_31120| Best HMM Match : Pox_F16 (HMM E-Value=5) 36 0.042 SB_48112| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.042 SB_25497| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.056 SB_37654| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.074 SB_57637| Best HMM Match : SRP40_C (HMM E-Value=2.3e-08) 35 0.074 SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.074 SB_40344| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.074 SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30) 34 0.098 SB_38808| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.098 SB_26110| Best HMM Match : HipA_C (HMM E-Value=5.5) 34 0.098 SB_14729| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.098 SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28) 34 0.098 SB_14726| Best HMM Match : Ribosomal_L30 (HMM E-Value=6.6) 34 0.13 SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) 34 0.13 SB_19427| Best HMM Match : RVT_1 (HMM E-Value=7.5e-32) 34 0.13 SB_51961| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_33578| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00076) 33 0.30 SB_17278| Best HMM Match : RVT_1 (HMM E-Value=0.0082) 33 0.30 SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27) 33 0.30 SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39) 33 0.30 SB_47667| Best HMM Match : Ldl_recept_a (HMM E-Value=0) 32 0.52 SB_30049| Best HMM Match : FBA_2 (HMM E-Value=7) 31 0.69 SB_28584| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.91 SB_2368| Best HMM Match : Patched (HMM E-Value=8.6e-08) 31 0.91 SB_19530| Best HMM Match : EMI (HMM E-Value=3.5) 31 1.2 SB_31047| Best HMM Match : CHORD (HMM E-Value=6.2) 30 1.6 SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_25515| Best HMM Match : Complex1_LYR (HMM E-Value=9.6) 30 2.1 SB_47421| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_57001| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_53803| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_26191| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_45836| Best HMM Match : EGF (HMM E-Value=6.7e-21) 28 6.4 SB_35989| Best HMM Match : SEC-C (HMM E-Value=3.5) 28 8.5 SB_11879| Best HMM Match : WD40 (HMM E-Value=5.8e-21) 28 8.5 SB_37127| Best HMM Match : DUF352 (HMM E-Value=3.3) 28 8.5 SB_8123| Best HMM Match : Tfb2 (HMM E-Value=0.00019) 28 8.5 SB_7214| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 >SB_16492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 43.2 bits (97), Expect = 2e-04 Identities = 24/84 (28%), Positives = 45/84 (53%), Gaps = 1/84 (1%) Frame = -1 Query: 369 TDRLEPLSLRRDFGSLCILYRMFHGKCSEEMFEII-PASRFYHSTARHRSRIHPYYLEPL 193 T +L PL RRD L +L+++ +G S + ++ PA+ Y++ H + ++ Sbjct: 187 TLKLLPLEYRRDITDLVLLFKIKNGDVSISLASLLSPATSRYNTRNYHSNNYRLFFTH-- 244 Query: 192 RSSTVRFQRSFLLRTIRLWNELPS 121 + ++ S+ RT++LWN LPS Sbjct: 245 --NQNYYRNSYFPRTVKLWNSLPS 266 >SB_54752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 792 Score = 42.7 bits (96), Expect = 3e-04 Identities = 29/85 (34%), Positives = 44/85 (51%), Gaps = 2/85 (2%) Frame = -1 Query: 369 TDRLEPLSLRRDFGSLCILYRMFHGKCSEEMFEIIPASRFYHSTARHRSR-IHPYYLEPL 193 T +L PL RRD L +L+++ +G S I AS +T+R+ +R HP Sbjct: 684 TLKLLPLEYRRDITDLVLLFKIKNGDVS-----ISSASLLSPATSRYNTRSYHPNNYRLF 738 Query: 192 RSSTVRFQR-SFLLRTIRLWNELPS 121 + + R S+ RT++LWN LPS Sbjct: 739 STHNQNYYRNSYFPRTVKLWNSLPS 763 >SB_20783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 42.7 bits (96), Expect = 3e-04 Identities = 29/85 (34%), Positives = 44/85 (51%), Gaps = 2/85 (2%) Frame = -1 Query: 369 TDRLEPLSLRRDFGSLCILYRMFHGKCSEEMFEIIPASRFYHSTARHRSR-IHPYYLEPL 193 T +L PL RRD L +L+++ +G S I AS +T+R+ +R HP Sbjct: 187 TLKLLPLEYRRDITDLVLLFKIKNGDVS-----ISSASLLSPATSRYNTRSYHPNNYRLF 241 Query: 192 RSSTVRFQR-SFLLRTIRLWNELPS 121 + + R S+ RT++LWN LPS Sbjct: 242 STHNQNYYRNSYFPRTVKLWNSLPS 266 >SB_51257| Best HMM Match : Pox_F16 (HMM E-Value=4.1) Length = 243 Score = 39.5 bits (88), Expect = 0.003 Identities = 30/99 (30%), Positives = 42/99 (42%) Frame = -1 Query: 357 EPLSLRRDFGSLCILYRMFHGKCSEEMFEIIPASRFYHSTARHRSRIHPYYLEPLRSSTV 178 + L +RR LC+ Y K + I +F + R R+ Y ++S+ + Sbjct: 141 DSLEVRRQLAQLCLFY-----KIRNNLVNIALPQQFQPNLRRSRTNSSKY--NQIQSNVL 193 Query: 177 RFQRSFLLRTIRLWNELPSTVFPERYDMSFFKRGLWRVL 61 SF RTIR WN LPS V E + FK VL Sbjct: 194 SHSYSFFPRTIRTWNLLPSEVV-ESSSIDSFKSSALPVL 231 >SB_58989| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 885 Score = 39.1 bits (87), Expect = 0.003 Identities = 21/57 (36%), Positives = 28/57 (49%) Frame = -1 Query: 234 RHRSRIHPYYLEPLRSSTVRFQRSFLLRTIRLWNELPSTVFPERYDMSFFKRGLWRV 64 R R HP PL +S+ SF RTI WN LP+ +F E + FK + R+ Sbjct: 823 RKTRRSHPESFIPLSTSSASEHLSFFSRTIIQWNNLPALLFNEPCSLPIFKDKISRL 879 >SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 918 Score = 37.1 bits (82), Expect = 0.014 Identities = 29/99 (29%), Positives = 41/99 (41%) Frame = -1 Query: 357 EPLSLRRDFGSLCILYRMFHGKCSEEMFEIIPASRFYHSTARHRSRIHPYYLEPLRSSTV 178 + L +RR LC+ Y K + I +F + R+ Y ++S+ + Sbjct: 816 DSLEVRRQLAQLCLFY-----KIRNNLVNIALPQQFQPNLRPSRTNSSKY--NQIQSNVL 868 Query: 177 RFQRSFLLRTIRLWNELPSTVFPERYDMSFFKRGLWRVL 61 SF RTIR WN LPS V E + FK VL Sbjct: 869 SHSYSFFPRTIRTWNLLPSEVI-ESSSIDSFKSSALPVL 906 >SB_31373| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) Length = 198 Score = 37.1 bits (82), Expect = 0.014 Identities = 29/99 (29%), Positives = 41/99 (41%) Frame = -1 Query: 357 EPLSLRRDFGSLCILYRMFHGKCSEEMFEIIPASRFYHSTARHRSRIHPYYLEPLRSSTV 178 + L +RR LC+ Y K + I +F + R+ Y ++S+ + Sbjct: 96 DSLEVRRQLAQLCLFY-----KIRNNLVNIALPQQFQPNLRPSRTNSSKY--NQIQSNVL 148 Query: 177 RFQRSFLLRTIRLWNELPSTVFPERYDMSFFKRGLWRVL 61 SF RTIR WN LPS V E + FK VL Sbjct: 149 SHSYSFFPRTIRTWNLLPSEVI-ESSSIDSFKSSALPVL 186 >SB_40765| Best HMM Match : DX (HMM E-Value=1.4) Length = 278 Score = 37.1 bits (82), Expect = 0.014 Identities = 28/93 (30%), Positives = 43/93 (46%) Frame = -1 Query: 351 LSLRRDFGSLCILYRMFHGKCSEEMFEIIPASRFYHSTARHRSRIHPYYLEPLRSSTVRF 172 L LRR L +LY++ G+ + + R + S YY E +++ ++ Sbjct: 183 LELRRTMARLTLLYKLSRGQIDIDTSTYL---RPHQDLRTRNSHNFKYYQE--KATKNKY 237 Query: 171 QRSFLLRTIRLWNELPSTVFPERYDMSFFKRGL 73 SF RTIR WN LP+ + E + FKR L Sbjct: 238 FYSFFPRTIRHWNTLPNELV-ELDSIEHFKRDL 269 >SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) Length = 837 Score = 37.1 bits (82), Expect = 0.014 Identities = 29/99 (29%), Positives = 41/99 (41%) Frame = -1 Query: 357 EPLSLRRDFGSLCILYRMFHGKCSEEMFEIIPASRFYHSTARHRSRIHPYYLEPLRSSTV 178 + L +RR LC+ Y K + I +F + R+ Y ++S+ + Sbjct: 735 DSLEVRRQLAQLCLFY-----KIRNNLVNIALPQQFQPNLRPSRTNSSKY--NQIQSNVL 787 Query: 177 RFQRSFLLRTIRLWNELPSTVFPERYDMSFFKRGLWRVL 61 SF RTIR WN LPS V E + FK VL Sbjct: 788 SHSYSFFPRTIRTWNLLPSEVI-ESSSIDSFKSSALPVL 825 >SB_43828| Best HMM Match : XPG_N (HMM E-Value=1.8) Length = 174 Score = 36.7 bits (81), Expect = 0.018 Identities = 28/93 (30%), Positives = 43/93 (46%) Frame = -1 Query: 351 LSLRRDFGSLCILYRMFHGKCSEEMFEIIPASRFYHSTARHRSRIHPYYLEPLRSSTVRF 172 L LRR L +LY++ G+ + + R + S YY E +++ ++ Sbjct: 79 LELRRTMARLTLLYKLSRGQIDIDTSMYL---RPHQDLRTRNSHNFKYYQE--KATKNKY 133 Query: 171 QRSFLLRTIRLWNELPSTVFPERYDMSFFKRGL 73 SF RTIR WN LP+ + E + FKR L Sbjct: 134 FYSFFPRTIRHWNTLPNELV-ELGSIEHFKRDL 165 >SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) Length = 361 Score = 36.7 bits (81), Expect = 0.018 Identities = 28/93 (30%), Positives = 43/93 (46%) Frame = -1 Query: 351 LSLRRDFGSLCILYRMFHGKCSEEMFEIIPASRFYHSTARHRSRIHPYYLEPLRSSTVRF 172 L LRR L +LY++ G+ + + R + S YY E +++ ++ Sbjct: 266 LELRRTMARLTLLYKLSRGQIDIDTSMYL---RPHQDLRTRNSHNFKYYQE--KATKNKY 320 Query: 171 QRSFLLRTIRLWNELPSTVFPERYDMSFFKRGL 73 SF RTIR WN LP+ + E + FKR L Sbjct: 321 FYSFFPRTIRHWNTLPNELV-ELGSIEHFKRDL 352 >SB_4935| Best HMM Match : Pox_F16 (HMM E-Value=5.3) Length = 243 Score = 36.7 bits (81), Expect = 0.018 Identities = 29/99 (29%), Positives = 41/99 (41%) Frame = -1 Query: 357 EPLSLRRDFGSLCILYRMFHGKCSEEMFEIIPASRFYHSTARHRSRIHPYYLEPLRSSTV 178 + L +RR LC+ Y K + I +F + R+ Y ++S+ + Sbjct: 141 DSLEVRRQLAQLCLFY-----KIRNNLVNIALPQQFQPNLRPSRTNSSKY--NQIQSNVL 193 Query: 177 RFQRSFLLRTIRLWNELPSTVFPERYDMSFFKRGLWRVL 61 SF RTIR WN LPS V E + FK VL Sbjct: 194 SHSYSFFPRTIRTWNLLPSEVV-ESSSIDSFKSSALPVL 231 >SB_33076| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) Length = 152 Score = 36.7 bits (81), Expect = 0.018 Identities = 29/99 (29%), Positives = 41/99 (41%) Frame = -1 Query: 357 EPLSLRRDFGSLCILYRMFHGKCSEEMFEIIPASRFYHSTARHRSRIHPYYLEPLRSSTV 178 + L +RR LC+ Y K + I +F + R+ Y ++S+ + Sbjct: 50 DSLEVRRQLAQLCLFY-----KIRNNLVNIALPQQFQPNLRPSRTNSSKY--NQIQSNVL 102 Query: 177 RFQRSFLLRTIRLWNELPSTVFPERYDMSFFKRGLWRVL 61 SF RTIR WN LPS V E + FK VL Sbjct: 103 SHSYSFFPRTIRTWNLLPSEVV-ESSSIDSFKSSALPVL 140 >SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 666 Score = 36.7 bits (81), Expect = 0.018 Identities = 28/93 (30%), Positives = 43/93 (46%) Frame = -1 Query: 351 LSLRRDFGSLCILYRMFHGKCSEEMFEIIPASRFYHSTARHRSRIHPYYLEPLRSSTVRF 172 L LRR L +LY++ G+ + + R + S YY E +++ ++ Sbjct: 571 LELRRTMARLTLLYKLSRGQIDIDTSMYL---RPHQDLRTRNSHNFKYYQE--KATKNKY 625 Query: 171 QRSFLLRTIRLWNELPSTVFPERYDMSFFKRGL 73 SF RTIR WN LP+ + E + FKR L Sbjct: 626 FYSFFPRTIRHWNTLPNELV-ELGSIEHFKRDL 657 >SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) Length = 375 Score = 36.3 bits (80), Expect = 0.024 Identities = 28/93 (30%), Positives = 43/93 (46%) Frame = -1 Query: 351 LSLRRDFGSLCILYRMFHGKCSEEMFEIIPASRFYHSTARHRSRIHPYYLEPLRSSTVRF 172 L LRR L +LY++ G+ + + R + S YY E +++ ++ Sbjct: 280 LELRRTMARLTLLYKLSRGQIDIDTNMYL---RPHQDLRTRNSHNFKYYQE--KATKNKY 334 Query: 171 QRSFLLRTIRLWNELPSTVFPERYDMSFFKRGL 73 SF RTIR WN LP+ + E + FKR L Sbjct: 335 FYSFFPRTIRHWNTLPNELV-ELGSIEHFKRDL 366 >SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 581 Score = 36.3 bits (80), Expect = 0.024 Identities = 28/93 (30%), Positives = 43/93 (46%) Frame = -1 Query: 351 LSLRRDFGSLCILYRMFHGKCSEEMFEIIPASRFYHSTARHRSRIHPYYLEPLRSSTVRF 172 L LRR L +LY++ G+ + + R + S YY E +++ ++ Sbjct: 486 LELRRTMARLTLLYKLSRGQIDIDTNMYL---RPHQDLRTRNSHNFKYYQE--KATKNKY 540 Query: 171 QRSFLLRTIRLWNELPSTVFPERYDMSFFKRGL 73 SF RTIR WN LP+ + E + FKR L Sbjct: 541 FYSFFPRTIRHWNTLPNELV-ELGSIEHFKRDL 572 >SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 788 Score = 36.3 bits (80), Expect = 0.024 Identities = 27/92 (29%), Positives = 39/92 (42%) Frame = -1 Query: 357 EPLSLRRDFGSLCILYRMFHGKCSEEMFEIIPASRFYHSTARHRSRIHPYYLEPLRSSTV 178 + L +RR LC+ Y K + I +F + R+ Y ++S+ + Sbjct: 507 DSLEVRRQLAQLCLFY-----KIRNNLVNIALPQQFQPNLRPSRTNSSKY--NQIQSNVL 559 Query: 177 RFQRSFLLRTIRLWNELPSTVFPERYDMSFFK 82 SF RTIR WN LPS V E + FK Sbjct: 560 SHSYSFFPRTIRTWNLLPSEVI-ESSSIDSFK 590 >SB_7946| Best HMM Match : DUF434 (HMM E-Value=7.5) Length = 294 Score = 35.9 bits (79), Expect = 0.032 Identities = 26/77 (33%), Positives = 38/77 (49%) Frame = -1 Query: 354 PLSLRRDFGSLCILYRMFHGKCSEEMFEIIPASRFYHSTARHRSRIHPYYLEPLRSSTVR 175 PLS RR L + Y+ + K + E+ + I T + RS HP L +T Sbjct: 205 PLSKRRQNARLTLFYKAVNKKSALEIPDNID-----RRTRQLRSS-HPDKFIELCPTTEA 258 Query: 174 FQRSFLLRTIRLWNELP 124 ++ SF RTI+ WN+LP Sbjct: 259 YKNSFFCRTIKEWNKLP 275 >SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23) Length = 2386 Score = 35.9 bits (79), Expect = 0.032 Identities = 24/81 (29%), Positives = 35/81 (43%) Frame = -1 Query: 357 EPLSLRRDFGSLCILYRMFHGKCSEEMFEIIPASRFYHSTARHRSRIHPYYLEPLRSSTV 178 + L +RR LC+ Y K + I +F + R+ Y ++S+ + Sbjct: 403 DSLEVRRQLAQLCLFY-----KIRNNLVNIALPQQFQPNLRPSRTNSSKY--NQIQSNVL 455 Query: 177 RFQRSFLLRTIRLWNELPSTV 115 SF RTIR WN LPS V Sbjct: 456 SHSYSFFPRTIRTWNLLPSEV 476 >SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1) Length = 2075 Score = 35.5 bits (78), Expect = 0.042 Identities = 21/57 (36%), Positives = 29/57 (50%) Frame = -1 Query: 225 SRIHPYYLEPLRSSTVRFQRSFLLRTIRLWNELPSTVFPERYDMSFFKRGLWRVLSD 55 SR H L+++ + F SF RTIR WN LP+ V D+ FK L +S+ Sbjct: 1627 SRRHSRTYHQLQANILAFNYSFFPRTIRTWNLLPAEVV-NAADLPSFKSALAPAISE 1682 >SB_31120| Best HMM Match : Pox_F16 (HMM E-Value=5) Length = 284 Score = 35.5 bits (78), Expect = 0.042 Identities = 28/99 (28%), Positives = 41/99 (41%) Frame = -1 Query: 357 EPLSLRRDFGSLCILYRMFHGKCSEEMFEIIPASRFYHSTARHRSRIHPYYLEPLRSSTV 178 + L +RR LC+ Y K + I +F + R+ Y ++S+ + Sbjct: 182 DSLEVRRQLAQLCLFY-----KIRNNLVNIALPQQFQPNLRPSRTNSSKY--NQIQSNVL 234 Query: 177 RFQRSFLLRTIRLWNELPSTVFPERYDMSFFKRGLWRVL 61 SF RTIR WN LP+ V E + FK VL Sbjct: 235 SHSYSFFPRTIRTWNLLPAQVV-ESSSIDSFKSSALPVL 272 >SB_48112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 232 Score = 35.5 bits (78), Expect = 0.042 Identities = 29/95 (30%), Positives = 44/95 (46%) Frame = -1 Query: 357 EPLSLRRDFGSLCILYRMFHGKCSEEMFEIIPASRFYHSTARHRSRIHPYYLEPLRSSTV 178 +PL RR SL +L + + +++ SR A R++ +Y P + T Sbjct: 144 QPLEDRRRTSSLVLLNSGLNNASILPLEDLMKPSR-----ALPRTQHSEFYTIP-NARTD 197 Query: 177 RFQRSFLLRTIRLWNELPSTVFPERYDMSFFKRGL 73 ++ SFL R +RLWN LP +V R F GL Sbjct: 198 IYKYSFLPRALRLWNNLPQSVIDMRGCPEAFHAGL 232 >SB_25497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 35.1 bits (77), Expect = 0.056 Identities = 24/76 (31%), Positives = 34/76 (44%) Frame = -1 Query: 342 RRDFGSLCILYRMFHGKCSEEMFEIIPASRFYHSTARHRSRIHPYYLEPLRSSTVRFQRS 163 +R S IL+ FH + +R ST R Y L+++T+ F S Sbjct: 266 QRRLTSQAILFYKFHNSLIHAKLPDL-VTRSTRSTRRKE-----LYYNQLQANTLAFNYS 319 Query: 162 FLLRTIRLWNELPSTV 115 F R IR+WN LP+ V Sbjct: 320 FFARAIRIWNLLPNDV 335 >SB_37654| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 865 Score = 34.7 bits (76), Expect = 0.074 Identities = 22/83 (26%), Positives = 34/83 (40%) Frame = -1 Query: 357 EPLSLRRDFGSLCILYRMFHGKCSEEMFEIIPASRFYHSTARHRSRIHPYYLEPLRSSTV 178 + L RR L + Y++ G + + + T + + L P + + Sbjct: 767 QSLQHRRIVSDLALFYKINSGLVKIDFLPDVSPKPAVYFTRTSACNSYQFSLLPAKINAF 826 Query: 177 RFQRSFLLRTIRLWNELPSTVFP 109 F SF RTI +WN LP VFP Sbjct: 827 LF--SFYSRTIPVWNALPQAVFP 847 >SB_57637| Best HMM Match : SRP40_C (HMM E-Value=2.3e-08) Length = 654 Score = 34.7 bits (76), Expect = 0.074 Identities = 29/100 (29%), Positives = 43/100 (43%), Gaps = 4/100 (4%) Frame = -1 Query: 354 PLSLRRDFGSLCILYRMFHGKCSEEMFEIIPASRFYHSTARHRSRIHPYYLEPLRSSTVR 175 P+ R F L + ++ HG + + E++ HS RS P S V Sbjct: 541 PVEFRVKFKILLLTFKAIHGIAPQYLSELVTIKP--HSAYNLRSNSGGKLQPPRIKSLVT 598 Query: 174 F-QRSFLLRTIRLWNELP---STVFPERYDMSFFKRGLWR 67 F RSF + +LWN LP S R++ + KRG +R Sbjct: 599 FGDRSFEISAPKLWNSLPLEISNGKSFRHEKTKKKRGSYR 638 >SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3142 Score = 34.7 bits (76), Expect = 0.074 Identities = 21/57 (36%), Positives = 28/57 (49%) Frame = -1 Query: 225 SRIHPYYLEPLRSSTVRFQRSFLLRTIRLWNELPSTVFPERYDMSFFKRGLWRVLSD 55 SR H L+++ + F SF RTIR WN LP+ V D+ FK L + D Sbjct: 1073 SRRHSRTYHQLQANILAFNYSFFPRTIRTWNLLPAEVV-NAADLPSFKSALAPAIID 1128 >SB_40344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 34.7 bits (76), Expect = 0.074 Identities = 26/77 (33%), Positives = 37/77 (48%) Frame = -1 Query: 354 PLSLRRDFGSLCILYRMFHGKCSEEMFEIIPASRFYHSTARHRSRIHPYYLEPLRSSTVR 175 PLS RR L + Y+ + K + ++ + I T + RS HP L T Sbjct: 314 PLSKRRQDARLTLFYKAVNKKSALKIPDNID-----RRTRQLRSS-HPDKFIELCPRTEA 367 Query: 174 FQRSFLLRTIRLWNELP 124 F+ SF RTI+ WN+LP Sbjct: 368 FKNSFFCRTIKEWNKLP 384 >SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30) Length = 1280 Score = 34.3 bits (75), Expect = 0.098 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -1 Query: 207 YLEPLRSSTVRFQRSFLLRTIRLWNELPSTV 115 Y L+++T+ F SF R IR+WN LP+ V Sbjct: 1221 YCNQLQANTLTFNYSFFARAIRIWNLLPNDV 1251 >SB_38808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 824 Score = 34.3 bits (75), Expect = 0.098 Identities = 27/93 (29%), Positives = 43/93 (46%) Frame = -1 Query: 351 LSLRRDFGSLCILYRMFHGKCSEEMFEIIPASRFYHSTARHRSRIHPYYLEPLRSSTVRF 172 L LRR L +LY++ G+ + + H R R+ H + +++ ++ Sbjct: 729 LELRRTMARLTLLYKLSRGQIDIDTNMYLRP----HQDLRTRNS-HNFKCYQEKATKNKY 783 Query: 171 QRSFLLRTIRLWNELPSTVFPERYDMSFFKRGL 73 SF RTIR WN LP+ + E + FKR L Sbjct: 784 FYSFFPRTIRHWNTLPNELV-ELGSIEHFKRDL 815 >SB_26110| Best HMM Match : HipA_C (HMM E-Value=5.5) Length = 210 Score = 34.3 bits (75), Expect = 0.098 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -1 Query: 207 YLEPLRSSTVRFQRSFLLRTIRLWNELPSTV 115 Y L+++T+ F SF R IR+WN LP+ V Sbjct: 151 YYNQLQANTLAFNYSFFARAIRIWNLLPNDV 181 >SB_14729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 34.3 bits (75), Expect = 0.098 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -1 Query: 207 YLEPLRSSTVRFQRSFLLRTIRLWNELPSTV 115 Y L+++T+ F SF R IR+WN LP+ V Sbjct: 256 YYNQLQANTLAFNYSFFARAIRIWNLLPNDV 286 >SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28) Length = 570 Score = 34.3 bits (75), Expect = 0.098 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -1 Query: 207 YLEPLRSSTVRFQRSFLLRTIRLWNELPSTV 115 Y L+++T+ F SF R IR+WN LP+ V Sbjct: 511 YYNQLQANTLAFNYSFFARAIRIWNLLPNDV 541 >SB_14726| Best HMM Match : Ribosomal_L30 (HMM E-Value=6.6) Length = 231 Score = 33.9 bits (74), Expect = 0.13 Identities = 18/48 (37%), Positives = 24/48 (50%) Frame = -1 Query: 216 HPYYLEPLRSSTVRFQRSFLLRTIRLWNELPSTVFPERYDMSFFKRGL 73 H + L + T ++ SFL R +RLWN LP +V R F GL Sbjct: 184 HSEFYTILNARTDIYKYSFLPRALRLWNNLPQSVIDMRGCPEAFHSGL 231 >SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) Length = 609 Score = 33.9 bits (74), Expect = 0.13 Identities = 23/77 (29%), Positives = 36/77 (46%) Frame = -1 Query: 351 LSLRRDFGSLCILYRMFHGKCSEEMFEIIPASRFYHSTARHRSRIHPYYLEPLRSSTVRF 172 L LRR L +LY++ G+ + + R + S YY E +++ ++ Sbjct: 512 LELRRTMARLTLLYKLSRGQIDIDTSMYL---RPHQDLRTRNSHNFKYYQE--KATKNKY 566 Query: 171 QRSFLLRTIRLWNELPS 121 SF RTIR WN LP+ Sbjct: 567 FYSFFPRTIRHWNTLPN 583 >SB_19427| Best HMM Match : RVT_1 (HMM E-Value=7.5e-32) Length = 698 Score = 33.9 bits (74), Expect = 0.13 Identities = 24/77 (31%), Positives = 39/77 (50%) Frame = -1 Query: 354 PLSLRRDFGSLCILYRMFHGKCSEEMFEIIPASRFYHSTARHRSRIHPYYLEPLRSSTVR 175 PLS RR L + Y+ + K + ++ + I T + RS + ++E L T Sbjct: 611 PLSKRRQDARLTLFYKAVNKKSALKIPDNID-----RRTRQLRSSLPDKFIE-LCPRTEA 664 Query: 174 FQRSFLLRTIRLWNELP 124 ++ SF RTI+ WN+LP Sbjct: 665 YKNSFFCRTIKEWNKLP 681 >SB_51961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 32.7 bits (71), Expect = 0.30 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = -1 Query: 225 SRIHPYYLEPLRSSTVRFQRSFLLRTIRLWNELPSTV 115 +R H + L+S+ + + SF R IR+WN LPS V Sbjct: 122 TRRHNHSFLQLQSNILSYNYSFFPRAIRIWNLLPSNV 158 >SB_33578| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00076) Length = 888 Score = 32.7 bits (71), Expect = 0.30 Identities = 19/56 (33%), Positives = 25/56 (44%) Frame = -1 Query: 267 IPASRFYHSTARHRSRIHPYYLEPLRSSTVRFQRSFLLRTIRLWNELPSTVFPERY 100 +P S R HP + + + T F+ SF+ R IRLWN L TV Y Sbjct: 713 LPLSTLSKPLRRSERTSHPEHYDIPYARTNIFKYSFVPRAIRLWNSLEVTVVLAAY 768 >SB_17278| Best HMM Match : RVT_1 (HMM E-Value=0.0082) Length = 506 Score = 32.7 bits (71), Expect = 0.30 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = -1 Query: 225 SRIHPYYLEPLRSSTVRFQRSFLLRTIRLWNELPSTV 115 +R H + L+S+ + + SF R IR+WN LPS V Sbjct: 441 TRRHNHSFLQLQSNILSYNYSFFPRAIRIWNLLPSNV 477 >SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27) Length = 1492 Score = 32.7 bits (71), Expect = 0.30 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = -1 Query: 225 SRIHPYYLEPLRSSTVRFQRSFLLRTIRLWNELPSTV 115 +R H + L+S+ + + SF R IR+WN LPS V Sbjct: 1427 TRRHNHSFLQLQSNILSYNYSFFPRAIRIWNLLPSNV 1463 >SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39) Length = 452 Score = 32.7 bits (71), Expect = 0.30 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = -1 Query: 225 SRIHPYYLEPLRSSTVRFQRSFLLRTIRLWNELPSTV 115 +R H + L+S+ + + SF R IR+WN LPS V Sbjct: 387 TRRHNHSFLQLQSNILSYNYSFFPRAIRIWNLLPSNV 423 >SB_47667| Best HMM Match : Ldl_recept_a (HMM E-Value=0) Length = 3891 Score = 31.9 bits (69), Expect = 0.52 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -2 Query: 158 CYVPSGYGMSSPPRCFPSAMTCPSSNEAC 72 C P GY + +P RC S +C SS AC Sbjct: 2147 CSCPQGYRLENPYRCVLSNASCASSEFAC 2175 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = -2 Query: 194 CGHPQCVSRDLFCYVPSGYGMSSPPRCFPSAMTCPSSNEAC 72 C +C+SRD C + G SS + +TCP+ C Sbjct: 3053 CPSGRCISRDWLCDGDNDCGDSSDEKAGECHVTCPAGQARC 3093 >SB_30049| Best HMM Match : FBA_2 (HMM E-Value=7) Length = 282 Score = 31.5 bits (68), Expect = 0.69 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = -1 Query: 195 LRSSTVRFQRSFLLRTIRLWNELPSTV 115 L+S+ + + SF R IR+WN LPS V Sbjct: 227 LQSNILSYNYSFFARAIRIWNLLPSNV 253 >SB_28584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 31.1 bits (67), Expect = 0.91 Identities = 19/74 (25%), Positives = 34/74 (45%), Gaps = 1/74 (1%) Frame = -1 Query: 333 FGSLC-ILYRMFHGKCSEEMFEIIPASRFYHSTARHRSRIHPYYLEPLRSSTVRFQRSFL 157 F S+C ++Y +G + + ++ HS S + +Y++ R R SF Sbjct: 69 FESVCHLMYDTRNGTAPPNILNLFTDTKSVHSYNTRSSTSNKFYIQKSRLEIQR--NSFS 126 Query: 156 LRTIRLWNELPSTV 115 R+WNELP ++ Sbjct: 127 RVGARVWNELPQSL 140 >SB_2368| Best HMM Match : Patched (HMM E-Value=8.6e-08) Length = 1420 Score = 31.1 bits (67), Expect = 0.91 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +3 Query: 198 APGSMDEFYSGGGRCYGKNEMPV 266 AP S+++F GGG C G+N +PV Sbjct: 770 APTSLEDFKWGGGPCLGENGVPV 792 >SB_19530| Best HMM Match : EMI (HMM E-Value=3.5) Length = 244 Score = 30.7 bits (66), Expect = 1.2 Identities = 25/80 (31%), Positives = 34/80 (42%), Gaps = 1/80 (1%) Frame = -1 Query: 351 LSLRRDFGSLCILYRMFHGKCSEEMFEIIPASRFYHSTARHRSRIHPYYLEPLRSSTVRF 172 L RR+ L YR+ G SE + Y T ++ HP + T F Sbjct: 158 LKERREKARLAFFYRINKG-LSEISMPPYATPQMYTITRQY----HPQRFALVSCKTNVF 212 Query: 171 QRSFLLRTIRLWNELP-STV 115 + SF IR+WN LP ST+ Sbjct: 213 KESFFPHAIRMWNGLPVSTI 232 >SB_31047| Best HMM Match : CHORD (HMM E-Value=6.2) Length = 251 Score = 30.3 bits (65), Expect = 1.6 Identities = 22/76 (28%), Positives = 33/76 (43%) Frame = -1 Query: 351 LSLRRDFGSLCILYRMFHGKCSEEMFEIIPASRFYHSTARHRSRIHPYYLEPLRSSTVRF 172 L +RR L + Y++ HG + +P + +RH Y P S+ Sbjct: 160 LEIRRKRARLLMFYKIHHGLVVTDGLPAVPPM---YIISRHMKS--QSYKVPPSSTDYHK 214 Query: 171 QRSFLLRTIRLWNELP 124 ++SF TIR WN LP Sbjct: 215 KKSFFPPTIRDWNCLP 230 >SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 662 Score = 29.9 bits (64), Expect = 2.1 Identities = 25/80 (31%), Positives = 34/80 (42%), Gaps = 1/80 (1%) Frame = -1 Query: 351 LSLRRDFGSLCILYRMFHGKCSEEMFEIIPASRFYHSTARHRSRIHPYYLEPLRSSTVRF 172 L RR+ L YR+ G SE + Y T ++ HP + T F Sbjct: 576 LKERREKARLAFFYRINKG-LSEISTPPYATPQMYTITRQY----HPQRFALVSCKTNVF 630 Query: 171 QRSFLLRTIRLWNELP-STV 115 + SF IR+WN LP ST+ Sbjct: 631 KESFFPHAIRMWNGLPVSTI 650 >SB_25515| Best HMM Match : Complex1_LYR (HMM E-Value=9.6) Length = 304 Score = 29.9 bits (64), Expect = 2.1 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 3/79 (3%) Frame = -1 Query: 351 LSLRRDFGSLCILYRMFHGKCSEEM-FEII--PASRFYHSTARHRSRIHPYYLEPLRSST 181 L LRR + Y++ HG + ++I P S S+ R+ ++ L P S Sbjct: 208 LELRRTVFDSVMFYKIHHGLVKIDFPSDVIRKPGSYATRSSVRNTCQLT---LPP--PSI 262 Query: 180 VRFQRSFLLRTIRLWNELP 124 +F+ SF RTI +WN LP Sbjct: 263 NQFKYSFFSRTIPVWNSLP 281 >SB_47421| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 323 Score = 29.5 bits (63), Expect = 2.8 Identities = 20/67 (29%), Positives = 30/67 (44%), Gaps = 1/67 (1%) Frame = -1 Query: 297 GKCSEEMFEIIPASRFYHSTARH-RSRIHPYYLEPLRSSTVRFQRSFLLRTIRLWNELPS 121 G +E F + R+ +T RH R I Y STV SFL+ + W++ + Sbjct: 60 GLTTEPFFAVYYVERY--TTKRHIRQGILVLYQIGQFVSTVAISSSFLIVLVLSWSQCVA 117 Query: 120 TVFPERY 100 +P RY Sbjct: 118 ITYPHRY 124 >SB_57001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1487 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/52 (28%), Positives = 23/52 (44%) Frame = +1 Query: 223 TPVAGGAMVKTRCRYNLEHFLRALPMEHTVQNTEGTEVPPQTQRFQTIRECL 378 T G +M + + +HFL L + EG + Q+Q TIR+ L Sbjct: 1151 TLTPGSSMAELSVAFRQQHFLVGLLLSELAMALEGCDFNLQSQAIDTIRDLL 1202 >SB_53803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 619 Score = 29.1 bits (62), Expect = 3.7 Identities = 25/87 (28%), Positives = 37/87 (42%) Frame = -2 Query: 329 VPSVFCTVCSMGSALRKCSRLYRHLVFTIAPPATGVEFIHTTWSHCGHPQCVSRDLFCYV 150 VP+V TV ++ S + ++VF+ P G IH+T CG PQC C + Sbjct: 393 VPNVVFTVPNVVSTVPNVVSTVPNVVFS---PQCG---IHST--QCGSPQCGIHSTQCGI 444 Query: 149 PSGYGMSSPPRCFPSAMTCPSSNEACG 69 S P+C + C + CG Sbjct: 445 HSTQCGIHSPQCGIHSPQCGIHSTQCG 471 >SB_26191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = -1 Query: 216 HPYYLEPLRSSTVRFQRSFLLRTI-RLW 136 HPYY E + SS + F+ + ++RTI R W Sbjct: 78 HPYYSERMLSSVLLFRENGIIRTIQREW 105 >SB_45836| Best HMM Match : EGF (HMM E-Value=6.7e-21) Length = 1332 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = -1 Query: 285 EEMFEIIPASRFYHSTARHRSRIHPYYLEPLRSSTVRFQRSFLLRTI 145 +E+ EII + + +R R YY+E L+S+ ++ + LL T+ Sbjct: 511 QELAEIIDTAISQSTKSRKRRSSPEYYVEILKSTAIKDESKTLLTTV 557 >SB_35989| Best HMM Match : SEC-C (HMM E-Value=3.5) Length = 203 Score = 27.9 bits (59), Expect = 8.5 Identities = 22/69 (31%), Positives = 31/69 (44%), Gaps = 5/69 (7%) Frame = -1 Query: 438 PTAYKIGLTFTLSRTLKNSY*ALTDRLEPLSLRRDFGSLCIL-----YRMFHGKCSEEMF 274 PT Y ++ +Y + T LE L L R + C+ YR+FHGK + M Sbjct: 128 PTEYARRFVSSIRVVCDTTYMSETLNLEML-LERRYKEKCVNGSGSPYRLFHGKLNANMI 186 Query: 273 EIIPASRFY 247 IP+S Y Sbjct: 187 R-IPSSSHY 194 >SB_11879| Best HMM Match : WD40 (HMM E-Value=5.8e-21) Length = 447 Score = 27.9 bits (59), Expect = 8.5 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = -2 Query: 269 LYRHLVFTIAPPATGVEFIHTTWSHCGHPQCVSRDLFC 156 L + LV P TG+ TTW G PQ D+ C Sbjct: 28 LDKSLVIWQPDPDTGIWIETTTWHEIGRPQVHGYDMQC 65 >SB_37127| Best HMM Match : DUF352 (HMM E-Value=3.3) Length = 256 Score = 27.9 bits (59), Expect = 8.5 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +1 Query: 253 TRCRYNLEHFLRALPMEHTVQNTEGTEVPPQTQRFQTIR 369 T CR+ L + + HTVQN+ TQ+++T+R Sbjct: 26 TVCRFELNRLM----IHHTVQNSTHKSTEQYTQQYRTVR 60 >SB_8123| Best HMM Match : Tfb2 (HMM E-Value=0.00019) Length = 448 Score = 27.9 bits (59), Expect = 8.5 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = -1 Query: 156 LRTIRLWNELPSTVFPERYDM-SFFKRGLWRVLSDRQRLGSAPGIA 22 L+ +R+W E+PS V +RY+M + F+ + L + GS P I+ Sbjct: 58 LKQLRIWREVPSGVH-KRYEMNATFRTNMKAALCGGESPGSNPIIS 102 >SB_7214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 505 Score = 27.9 bits (59), Expect = 8.5 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = -1 Query: 594 HRHLQLKCTTHLEI*VLRSQYSYKGCPTLRTETHYCFTALDSLPTFAT 451 H H++L T H I + +Q+S+ P+ + Y T LDS T+ T Sbjct: 351 HSHIRLPSTQHSHIRLPSTQHSHIRIPSTQPAFTYT-TPLDSALTYTT 397 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,097,052 Number of Sequences: 59808 Number of extensions: 536014 Number of successful extensions: 1363 Number of sequences better than 10.0: 58 Number of HSP's better than 10.0 without gapping: 1202 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1350 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1853669818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -