BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1091 (675 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP16F5.06 |||ribosome biogenesis protein Nop6|Schizosaccharomy... 28 1.1 SPAC3F10.10c |map3||pheromone M-factor receptor |Schizosaccharom... 27 3.3 SPBC36.01c |||spermidine family transporter |Schizosaccharomyces... 26 4.3 SPCC2H8.05c ||SPCC63.01c|sequence orphan|Schizosaccharomyces pom... 26 5.7 SPCC1739.11c |cdc11||SIN component scaffold protein Cdc11|Schizo... 25 7.6 SPAC6F6.17 |rif1|tap1, tap11, SPAPJ736.01|telomere length regula... 25 10.0 SPCC188.03 |cnd3||condensin subunit Cnd3 |Schizosaccharomyces po... 25 10.0 SPAC4A8.05c |myp2|myo3|myosin II heavy chain |Schizosaccharomyce... 25 10.0 SPACUNK4.16c |||alpha,alpha-trehalose-phosphate synthase |Schizo... 25 10.0 >SPBP16F5.06 |||ribosome biogenesis protein Nop6|Schizosaccharomyces pombe|chr 2|||Manual Length = 478 Score = 28.3 bits (60), Expect = 1.1 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +2 Query: 152 DQNRDPPRNSVVSGSFLWDELVIRNYIENITELRFFLDL 268 D +DPPR G + +V+R Y +N + RFF L Sbjct: 144 DVRKDPPRKGWKKGPYGRAIVVLRMYNKNTKKTRFFYPL 182 >SPAC3F10.10c |map3||pheromone M-factor receptor |Schizosaccharomyces pombe|chr 1|||Manual Length = 365 Score = 26.6 bits (56), Expect = 3.3 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 651 STLYLFSVFFFASTGWFYSSICLVW 577 + LYL S+FF S GW ++W Sbjct: 268 TVLYLMSLFFSTSGGWTEKVALILW 292 >SPBC36.01c |||spermidine family transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 580 Score = 26.2 bits (55), Expect = 4.3 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 2/56 (3%) Frame = +2 Query: 170 PRNSVVSGSFLWDELVIRNYIENITELRFFLD--LRGLLCNKTSI*AISEGRVQNY 331 P + + G FL + + E IT FL L L C +T + I+E +VQ Y Sbjct: 276 PLVAPIVGGFLTKSYLGWRWTEYITSFMGFLSIILIYLFCEETYLKTITENKVQEY 331 >SPCC2H8.05c ||SPCC63.01c|sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 217 Score = 25.8 bits (54), Expect = 5.7 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = +1 Query: 40 SILSRLTSKAIPSSPNK*ARVYGAKPEREQRFAESTTGSESRPAEKLS 183 S + R +S +PSS N R+ + R ES+ E+ A KLS Sbjct: 61 STIQRTSSLPVPSSSNFKERLNNIGGLKRSRTLESSYEDETETANKLS 108 >SPCC1739.11c |cdc11||SIN component scaffold protein Cdc11|Schizosaccharomyces pombe|chr 3|||Manual Length = 1045 Score = 25.4 bits (53), Expect = 7.6 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = -1 Query: 438 PHIRTVFIELVTNRHPPQI-AISTILNARDRPPQP-PT*FCTLPSL 307 PH+RT++++L PP I + ++N R P + F PSL Sbjct: 800 PHLRTLYMDLNRFNRPPDIRRLKRLVNFSFRTQDPEASNFVIQPSL 845 >SPAC6F6.17 |rif1|tap1, tap11, SPAPJ736.01|telomere length regulator protein Rif1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1400 Score = 25.0 bits (52), Expect = 10.0 Identities = 14/60 (23%), Positives = 27/60 (45%) Frame = +2 Query: 254 FFLDLRGLLCNKTSI*AISEGRVQNYVGGWGGRSRAFKIVDIAICGGCRFVTSSIKTVRI 433 F L RG+L T + +I + Q++ G + + + + + C G + K+ RI Sbjct: 58 FGLPKRGILKTSTPLSSIKQPNFQSFEGNESEKETSLQELQSSFCSGIENLQHVEKSARI 117 >SPCC188.03 |cnd3||condensin subunit Cnd3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 875 Score = 25.0 bits (52), Expect = 10.0 Identities = 12/57 (21%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Frame = +2 Query: 83 QTNRREFTG--LSLRESSASLNLPPDQNRDPPRNSVVSGSFLWDELVIRNYIENITE 247 + N+ ++ G +++ + S S +LPP++ +P + + ++EL +Y++ + E Sbjct: 450 ELNKNDYEGEEITVSQKSPSPSLPPNELNEPEPDDMDGYKEAFNELRCLSYVQCLFE 506 >SPAC4A8.05c |myp2|myo3|myosin II heavy chain |Schizosaccharomyces pombe|chr 1|||Manual Length = 2104 Score = 25.0 bits (52), Expect = 10.0 Identities = 18/47 (38%), Positives = 22/47 (46%) Frame = +2 Query: 98 EFTGLSLRESSASLNLPPDQNRDPPRNSVVSGSFLWDELVIRNYIEN 238 EFTGL S NLP Q P + SG E +IRN+ +N Sbjct: 1399 EFTGLKPLSPSKISNLPSSQPGSPSKR---SGKM---EALIRNFDQN 1439 >SPACUNK4.16c |||alpha,alpha-trehalose-phosphate synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 944 Score = 25.0 bits (52), Expect = 10.0 Identities = 8/24 (33%), Positives = 17/24 (70%) Frame = +2 Query: 119 RESSASLNLPPDQNRDPPRNSVVS 190 + +L+LPP +++ PP +SV++ Sbjct: 130 KNDGTNLSLPPSRHQSPPPSSVLA 153 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,564,824 Number of Sequences: 5004 Number of extensions: 51492 Number of successful extensions: 122 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 120 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 122 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 309878492 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -