BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1091 (675 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z83112-2|CAB05539.1| 391|Caenorhabditis elegans Hypothetical pr... 30 1.3 AF016673-4|AAB66125.2| 743|Caenorhabditis elegans Hypothetical ... 29 2.3 U70852-13|AAM98015.1| 788|Caenorhabditis elegans Gei-4(four) in... 28 7.0 >Z83112-2|CAB05539.1| 391|Caenorhabditis elegans Hypothetical protein K02B7.2 protein. Length = 391 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/54 (29%), Positives = 29/54 (53%) Frame = -3 Query: 352 PPSPTSNIILYSALADCSY*RFIA*QSS*VQKKS*LGNIFNIVANYEFIPQKRP 191 PP +N+ LY L CS+ ++ + + KK + + +VA YE I +++P Sbjct: 4 PPPSLTNVCLYPLLEKCSH--YVLEEFFQIFKKKVMSFLEKLVAKYEPIKEEKP 55 >AF016673-4|AAB66125.2| 743|Caenorhabditis elegans Hypothetical protein T06D4.3 protein. Length = 743 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -1 Query: 408 VTNRHPPQIAISTILNARDRPPQPPT*FCTLPSLI 304 VT PP + ST+ N+ RPP P C P + Sbjct: 61 VTTSRPPNLTTSTLPNSSSRPPSIP--ICDTPECV 93 >U70852-13|AAM98015.1| 788|Caenorhabditis elegans Gei-4(four) interacting proteinprotein 4, isoform b protein. Length = 788 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = +3 Query: 483 VSLQKQLRSDQVCKTQSIL*VT*RSILSLAFAKLGKLKNKTNQ 611 V Q+ R+D+ S+ VT R++ A KL K +NK NQ Sbjct: 7 VQSQQNERNDEAVLLNSLRNVTLRNVEKFASVKLPKEQNKRNQ 49 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,241,064 Number of Sequences: 27780 Number of extensions: 291819 Number of successful extensions: 721 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 686 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 721 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1529108810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -