BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1087 (738 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q38ZH2 Cluster: Hypothetical cell surface protein; n=1;... 33 5.5 UniRef50_Q036T8 Cluster: Surface antigen; n=1; Lactobacillus cas... 33 9.7 >UniRef50_Q38ZH2 Cluster: Hypothetical cell surface protein; n=1; Lactobacillus sakei subsp. sakei 23K|Rep: Hypothetical cell surface protein - Lactobacillus sakei subsp. sakei (strain 23K) Length = 424 Score = 33.5 bits (73), Expect = 5.5 Identities = 19/48 (39%), Positives = 23/48 (47%) Frame = +2 Query: 5 GDLTMLHQVIIALAVFTYVDGSGIGHAPATGPVVTSASSQYFERTFNR 148 GDL V A V Y+ HAPA G VT+ S QY++ F R Sbjct: 375 GDLVFWGGVGSAHHVGIYIGNGSYVHAPAPGQSVTTMSMQYYKPDFGR 422 >UniRef50_Q036T8 Cluster: Surface antigen; n=1; Lactobacillus casei ATCC 334|Rep: Surface antigen - Lactobacillus casei (strain ATCC 334) Length = 400 Score = 32.7 bits (71), Expect = 9.7 Identities = 20/48 (41%), Positives = 22/48 (45%) Frame = +2 Query: 5 GDLTMLHQVIIALAVFTYVDGSGIGHAPATGPVVTSASSQYFERTFNR 148 GDL V A V Y+ G HAPA G VT S YF +F R Sbjct: 351 GDLVFWGGVGSAYHVGIYIGGGQYLHAPAPGQNVTIQSMAYFAPSFGR 398 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 551,948,926 Number of Sequences: 1657284 Number of extensions: 9330986 Number of successful extensions: 66732 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 28569 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 60900 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 60088620670 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -