BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1085 (637 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC25B2.10 |||Usp |Schizosaccharomyces pombe|chr 2|||Manual 29 0.43 SPCC1840.03 |sal3|pse1|karyopherin Sal3|Schizosaccharomyces pomb... 26 5.2 SPAC15F9.02 |seh1||nucleoporin Seh1 |Schizosaccharomyces pombe|c... 26 5.2 SPAC1486.05 |nup189||nucleoporin Nup189|Schizosaccharomyces pomb... 25 6.9 SPCC1672.11c |||P-type ATPase |Schizosaccharomyces pombe|chr 3||... 25 9.1 >SPBC25B2.10 |||Usp |Schizosaccharomyces pombe|chr 2|||Manual Length = 307 Score = 29.5 bits (63), Expect = 0.43 Identities = 19/52 (36%), Positives = 23/52 (44%) Frame = -2 Query: 246 YHYIRMHQTSYPLGHVASLLKICGDTFKNIITLFFKLTVYVNHGQNYKFQGT 91 YH+ R H P L +I DTF N F LT+ H Q YK+ T Sbjct: 88 YHHGRSHSLVSPPPSPHFLKRISFDTFNNKAATDFSLTLKTQH-QAYKWTRT 138 >SPCC1840.03 |sal3|pse1|karyopherin Sal3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1095 Score = 25.8 bits (54), Expect = 5.2 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = -2 Query: 474 TETHYCFTAEIGREAVPTRADSEEVLPPVITQIIILGV*FLLHDVIPS 331 TE C+ AE+ +AD + + V+T +++ G+ F HD + S Sbjct: 684 TEMLVCYAAEL-------KADFDPYVNEVLTSVVLPGLKFFFHDGVRS 724 >SPAC15F9.02 |seh1||nucleoporin Seh1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 339 Score = 25.8 bits (54), Expect = 5.2 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 Query: 311 VTIDFHGEGITSCSKNQTPKI 373 VT DF+G + SCS +Q K+ Sbjct: 20 VTYDFYGRRMVSCSADQRVKV 40 >SPAC1486.05 |nup189||nucleoporin Nup189|Schizosaccharomyces pombe|chr 1|||Manual Length = 1778 Score = 25.4 bits (53), Expect = 6.9 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = -1 Query: 394 TSNNANYNFGGLIFTTRCYSFTVEVNRDQWLSTYFIRKIGTRLRDSN 254 T A++ FGG I++ + +Q L + +RKI L++ N Sbjct: 1681 TDGLASWRFGGQIYSDYLDLLEGNFDANQELKLFTLRKISVALKELN 1727 >SPCC1672.11c |||P-type ATPase |Schizosaccharomyces pombe|chr 3|||Manual Length = 1315 Score = 25.0 bits (52), Expect = 9.1 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -1 Query: 310 QWLSTYFIRKIGTR 269 +WL YFIR +GTR Sbjct: 187 RWLPKYFIRFVGTR 200 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,841,366 Number of Sequences: 5004 Number of extensions: 60856 Number of successful extensions: 129 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 126 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 129 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 283719918 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -