BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1080 (792 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 pro... 38 4e-04 >AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 protein protein. Length = 160 Score = 37.9 bits (84), Expect = 4e-04 Identities = 16/45 (35%), Positives = 28/45 (62%) Frame = +2 Query: 68 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPT 202 MA+ L + +I + + FS++D +G G + +LG +R+L NPT Sbjct: 1 MANDLKDVEIEKAQFVFSVYDWEGSGQMDAMDLGNALRALNLNPT 45 Score = 33.9 bits (74), Expect = 0.006 Identities = 20/63 (31%), Positives = 34/63 (53%) Frame = +2 Query: 101 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGEYT*NHMIYAK 280 +F E L+DK+ DGT+ EL + +LG+ + EL +++ + D E ++ YA Sbjct: 86 DFLECLKLYDKNEDGTMLLAELTHSLTALGERLDDVELDNVMKDC-MDPEDDDGNIPYAP 144 Query: 281 *LK 289 LK Sbjct: 145 FLK 147 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 657,452 Number of Sequences: 2352 Number of extensions: 11748 Number of successful extensions: 9 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83160600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -