Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-1075
         (725 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_01_0949 - 7317123-7317425,7317548-7317883,7317969-7318364           28   8.7  

>06_01_0949 - 7317123-7317425,7317548-7317883,7317969-7318364
          Length = 344

 Score = 27.9 bits (59), Expect = 8.7
 Identities = 11/40 (27%), Positives = 22/40 (55%)
 Frame = -2

Query: 274 VPQSINKRPTGDTILKKKQNCYFYLIPSIFIFIYLLNHLW 155
           +PQ+I++ P   T+     N + Y+ P+  +F+  + H W
Sbjct: 211 LPQAISEAPADGTVNFVAGNMFEYIPPANAVFLKYVLHCW 250


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,284,998
Number of Sequences: 37544
Number of extensions: 296648
Number of successful extensions: 494
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 485
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 494
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1898162308
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)