BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1071 (741 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z19154-4|CAA79556.1| 139|Caenorhabditis elegans Hypothetical pr... 31 1.1 AL117206-1|CAB60446.1| 644|Caenorhabditis elegans Hypothetical ... 29 2.6 AF026206-5|AAK39307.1| 141|Caenorhabditis elegans Hypothetical ... 28 6.0 >Z19154-4|CAA79556.1| 139|Caenorhabditis elegans Hypothetical protein C40H1.5 protein. Length = 139 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 3/38 (7%) Frame = +3 Query: 84 IALQLELVGD*KKLGISGKVRCRGKMG---LIKLYDRD 188 +A L+G+ + G+ GK+ C GK L+KLYD D Sbjct: 10 VASSYALIGNTQSAGVRGKLICNGKPAVGVLVKLYDDD 47 >AL117206-1|CAB60446.1| 644|Caenorhabditis elegans Hypothetical protein Y67A10A.1 protein. Length = 644 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = -1 Query: 345 CKLINSRSGLKITILGN-FICNLASSQILAHINYYYEHGNSLSSY*NPLLFLPHR 184 C+ + L + ++GN ++ N S I AH NY Y +S + LF HR Sbjct: 418 CRFAPGKGNLSVMMIGNSYVLNF-SEHIRAHFNYNYSDYRYMSVIASYGLFSDHR 471 >AF026206-5|AAK39307.1| 141|Caenorhabditis elegans Hypothetical protein T28B4.3 protein. Length = 141 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 3/39 (7%) Frame = +3 Query: 81 GIALQLELVGD*KKLGISGKVRCRGKMG---LIKLYDRD 188 G+A +E+ G + + GK+ C G+ L+KL+D+D Sbjct: 12 GVAASIEMFGRDQSSAVRGKLICDGRPASGVLVKLWDKD 50 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,091,809 Number of Sequences: 27780 Number of extensions: 292539 Number of successful extensions: 522 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 511 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 522 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1745954468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -