BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1069 (512 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g45540.1 68415.m05663 WD-40 repeat family protein / beige-rel... 27 5.6 At1g42560.1 68414.m04907 seven transmembrane MLO family protein ... 27 9.8 >At2g45540.1 68415.m05663 WD-40 repeat family protein / beige-related contains Pfam PF02138: Beige/BEACH domain; contains Pfam PF00400: WD domain, G-beta repeat (3 copies) Length = 2946 Score = 27.5 bits (58), Expect = 5.6 Identities = 15/52 (28%), Positives = 24/52 (46%) Frame = -1 Query: 275 VYMIS*NSYVKRVISLSWQLNSPYPMSR*SRIFHHGRPTSSDACDRCV*LFK 120 V ++ N RV WQ N+P +FHHG+ T++ + +FK Sbjct: 2553 VVIVDMNVPAARVAQHKWQPNTPDGQGT-PFLFHHGKATTTSTSGSLMRMFK 2603 >At1g42560.1 68414.m04907 seven transmembrane MLO family protein / MLO-like protein 9 (MLO9) nearly identical to membrane protein Mlo9 [Arabidopsis thaliana] GI:14091588; similar to MLO protein SWISS-PROT:P93766, NCBI_gi:1877221 [Hordeum vulgare][Barley] Length = 467 Score = 26.6 bits (56), Expect = 9.8 Identities = 8/23 (34%), Positives = 17/23 (73%) Frame = -2 Query: 211 PPIQCRVDHVFFITVDLLLRMHV 143 PP+ C+ D+V I+++ L ++H+ Sbjct: 137 PPVNCKKDYVALISLNALHQVHI 159 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,770,382 Number of Sequences: 28952 Number of extensions: 175156 Number of successful extensions: 350 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 347 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 350 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 927799552 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -