BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1064 (506 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP35G2.14 |||RNA-binding protein|Schizosaccharomyces pombe|chr... 29 0.40 SPAC31G5.15 |||phosphatidylserine decarboxylase |Schizosaccharom... 26 2.8 SPCC191.11 |inv1||beta-fructofuranosidase|Schizosaccharomyces po... 25 6.5 >SPBP35G2.14 |||RNA-binding protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 1060 Score = 29.1 bits (62), Expect = 0.40 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = -3 Query: 375 HKIRNS*CSGSTNARARR*YRASQNLQLWRYQFFGFGCGFLTP 247 H N+ SGS RAR+ R N W + FG G+ TP Sbjct: 230 HSASNAANSGSNTIRARQTTRTRSNTLPWSPRVFGPTLGYNTP 272 >SPAC31G5.15 |||phosphatidylserine decarboxylase |Schizosaccharomyces pombe|chr 1|||Manual Length = 980 Score = 26.2 bits (55), Expect = 2.8 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +2 Query: 362 FLILCFIAGFFLTLWDVNNANKTF*NSFFFKLGS 463 F+I F F T W +N N + F F++G+ Sbjct: 308 FVITAFSKNIFRTKWLRHNLNPVYNEKFLFEVGA 341 >SPCC191.11 |inv1||beta-fructofuranosidase|Schizosaccharomyces pombe|chr 3|||Manual Length = 581 Score = 25.0 bits (52), Expect = 6.5 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 410 VNNANKTF*NSFFFKLGS 463 VNN KT+ N FFF G+ Sbjct: 535 VNNGEKTYTNDFFFLQGA 552 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,979,078 Number of Sequences: 5004 Number of extensions: 39460 Number of successful extensions: 91 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 90 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 91 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 202220600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -