BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1060 (405 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9U6B8 Cluster: Calcium release-activated calcium chann... 49 3e-05 UniRef50_Q17KQ6 Cluster: Putative uncharacterized protein; n=1; ... 45 5e-04 UniRef50_Q74A80 Cluster: Putative uncharacterized protein; n=1; ... 32 5.0 UniRef50_A5D0J2 Cluster: Putative uncharacterized protein; n=1; ... 31 8.7 UniRef50_Q96SN7 Cluster: Protein orai-2; n=28; Coelomata|Rep: Pr... 31 8.7 UniRef50_Q8BWG9 Cluster: Calcium release-activated calcium chann... 31 8.7 UniRef50_Q96D31 Cluster: Calcium release-activated calcium chann... 31 8.7 >UniRef50_Q9U6B8 Cluster: Calcium release-activated calcium channel protein 1; n=17; Eumetazoa|Rep: Calcium release-activated calcium channel protein 1 - Drosophila melanogaster (Fruit fly) Length = 351 Score = 49.2 bits (112), Expect = 3e-05 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = +1 Query: 325 QSGDGLHTPAYLSWRKLQLSRAKLK 399 QSG+ LH+P YLSWRKLQLSRAKLK Sbjct: 135 QSGEDLHSPTYLSWRKLQLSRAKLK 159 >UniRef50_Q17KQ6 Cluster: Putative uncharacterized protein; n=1; Aedes aegypti|Rep: Putative uncharacterized protein - Aedes aegypti (Yellowfever mosquito) Length = 368 Score = 45.2 bits (102), Expect = 5e-04 Identities = 21/28 (75%), Positives = 23/28 (82%) Frame = +1 Query: 316 TPIQSGDGLHTPAYLSWRKLQLSRAKLK 399 T QSGD ++P YLSWRKLQLSRAKLK Sbjct: 153 TMSQSGDEYNSPNYLSWRKLQLSRAKLK 180 >UniRef50_Q74A80 Cluster: Putative uncharacterized protein; n=1; Geobacter sulfurreducens|Rep: Putative uncharacterized protein - Geobacter sulfurreducens Length = 308 Score = 31.9 bits (69), Expect = 5.0 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 158 LVTSKPQKEGLSCNLFRTEWLHNEIPNILF 247 LV + P GL C F WLH ++P L+ Sbjct: 174 LVVAVPDAGGLQCGFFGRHWLHLDVPRHLY 203 >UniRef50_A5D0J2 Cluster: Putative uncharacterized protein; n=1; Pelotomaculum thermopropionicum SI|Rep: Putative uncharacterized protein - Pelotomaculum thermopropionicum SI Length = 233 Score = 31.1 bits (67), Expect = 8.7 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +2 Query: 296 SALCRVRRRYSRGTGFIRRRTSRGGSCSLVG 388 S +CR+ RR R GF+R R GG C L G Sbjct: 150 SMVCRIERR-GREMGFVRARGFIGGCCRLCG 179 >UniRef50_Q96SN7 Cluster: Protein orai-2; n=28; Coelomata|Rep: Protein orai-2 - Homo sapiens (Human) Length = 254 Score = 31.1 bits (67), Expect = 8.7 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = +1 Query: 343 HTPAYLSWRKLQLSRAKLK 399 H+ LSWRKL LSRAKLK Sbjct: 43 HSVQALSWRKLYLSRAKLK 61 >UniRef50_Q8BWG9 Cluster: Calcium release-activated calcium channel protein 1; n=15; Euteleostomi|Rep: Calcium release-activated calcium channel protein 1 - Mus musculus (Mouse) Length = 304 Score = 31.1 bits (67), Expect = 8.7 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = +1 Query: 343 HTPAYLSWRKLQLSRAKLK 399 H+ LSWRKL LSRAKLK Sbjct: 71 HSMQALSWRKLYLSRAKLK 89 >UniRef50_Q96D31 Cluster: Calcium release-activated calcium channel protein 1; n=8; Eutheria|Rep: Calcium release-activated calcium channel protein 1 - Homo sapiens (Human) Length = 301 Score = 31.1 bits (67), Expect = 8.7 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = +1 Query: 343 HTPAYLSWRKLQLSRAKLK 399 H+ LSWRKL LSRAKLK Sbjct: 69 HSMQALSWRKLYLSRAKLK 87 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 377,735,146 Number of Sequences: 1657284 Number of extensions: 6790511 Number of successful extensions: 13741 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 13449 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13739 length of database: 575,637,011 effective HSP length: 92 effective length of database: 423,166,883 effective search space used: 17773009086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -