BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1060 (405 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z79755-1|CAB02111.2| 358|Caenorhabditis elegans Hypothetical pr... 27 3.9 U41263-13|AAC24428.2| 1844|Caenorhabditis elegans Hypothetical p... 26 9.0 >Z79755-1|CAB02111.2| 358|Caenorhabditis elegans Hypothetical protein F43G9.1 protein. Length = 358 Score = 27.5 bits (58), Expect = 3.9 Identities = 11/50 (22%), Positives = 23/50 (46%) Frame = -2 Query: 299 HLCFYKRIDLISCFSDQRIEYSGFRYAAIQS*TSCTTILPSEASRSLAGY 150 H Y +D+++ + EYSG + + ++ ASR++A + Sbjct: 126 HKTLYDNVDVVTIRENTEGEYSGIEHEIVPGVVQSIKLITETASRNVASF 175 >U41263-13|AAC24428.2| 1844|Caenorhabditis elegans Hypothetical protein T19D12.1 protein. Length = 1844 Score = 26.2 bits (55), Expect = 9.0 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -3 Query: 373 TSSTRGTPAYEARPPTVSASHPT 305 T ST+G P + PT S S+PT Sbjct: 484 TPSTQGVPTSTSNQPTPSTSNPT 506 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,742,841 Number of Sequences: 27780 Number of extensions: 164385 Number of successful extensions: 270 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 267 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 270 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 641068680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -