BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1052 (621 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 24 1.2 AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 23 2.1 AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 21 8.3 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 23.8 bits (49), Expect = 1.2 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +1 Query: 22 ISLVQCRTIYLELNSPTLDE 81 ++ VQCR+I E PT DE Sbjct: 77 VARVQCRSIKNECPEPTCDE 96 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 23.0 bits (47), Expect = 2.1 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -2 Query: 527 PGPSKGNPSPWLPEAK*TCMSALP 456 P PS +P P LP A C + LP Sbjct: 153 PNPSIIDPGPALPPAGFLCNNYLP 176 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 21.0 bits (42), Expect = 8.3 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +1 Query: 64 SPTLDEVNFLLQYGYLSKDLAGVGYTYTSQSISEAVK 174 +P L + L GY+ D+ G G Y + ++EAV+ Sbjct: 117 APNLTYLLVALYSGYVWTDILGFG--YFREYLAEAVQ 151 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,497 Number of Sequences: 336 Number of extensions: 3887 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15875032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -