BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1051 (677 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC18.06c |caf1|pop2|CCR4-Not complex subunit Caf1|Schizosaccha... 29 0.82 SPCC18.08 |||lysine-tRNA ligase|Schizosaccharomyces pombe|chr 3|... 27 3.3 SPAC1952.01 ||SPAC1B3.19|Pig-U|Schizosaccharomyces pombe|chr 1||... 26 4.4 SPAC6F6.18c |mug169||sequence orphan|Schizosaccharomyces pombe|c... 26 5.8 >SPCC18.06c |caf1|pop2|CCR4-Not complex subunit Caf1|Schizosaccharomyces pombe|chr 3|||Manual Length = 332 Score = 28.7 bits (61), Expect = 0.82 Identities = 12/29 (41%), Positives = 22/29 (75%) Frame = +2 Query: 527 NVNFNKVALGLRAVSSRITPIK*LFSSTI 613 N NF+ ALG+ +SS+I+PI+ ++S+ + Sbjct: 2 NSNFSYPALGVDGISSQISPIRDVWSTNL 30 >SPCC18.08 |||lysine-tRNA ligase|Schizosaccharomyces pombe|chr 3|||Manual Length = 531 Score = 26.6 bits (56), Expect = 3.3 Identities = 16/54 (29%), Positives = 26/54 (48%) Frame = -3 Query: 504 FNDLIRR*NILY*LELYFKIIKVVPNLFSFKFITKIITPIVQLRIGGLHGRTTI 343 F D++ L LE ++II+ + FS + ++ TPI+ GG R I Sbjct: 191 FVDMMSNTKSLELLEKRYRIIESIRKFFSERGFLEVETPILSHHFGGATARPFI 244 >SPAC1952.01 ||SPAC1B3.19|Pig-U|Schizosaccharomyces pombe|chr 1|||Manual Length = 408 Score = 26.2 bits (55), Expect = 4.4 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 Query: 83 LDSTGRMSNF*IWWVFFTLLLKTFVRF 3 LDS N +WW FFT + F F Sbjct: 240 LDSHDLTPNLGLWWYFFTEMFNEFRTF 266 >SPAC6F6.18c |mug169||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 121 Score = 25.8 bits (54), Expect = 5.8 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -3 Query: 207 HRSIVKGNIVQMTSVVLDNFLRSVCPGA 124 +RSI +G I T ++D F R V PG+ Sbjct: 92 NRSIKEGIICNFTRSIIDPFSRIVLPGS 119 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,489,665 Number of Sequences: 5004 Number of extensions: 45695 Number of successful extensions: 82 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 81 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 311890690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -