BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1051 (677 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 23 2.0 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 23 2.0 DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 23 3.5 DQ384991-1|ABD51779.1| 94|Apis mellifera allergen Api m 6 vari... 21 8.2 DQ384990-1|ABD51778.1| 92|Apis mellifera allergen Api m 6 vari... 21 8.2 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 23.4 bits (48), Expect = 2.0 Identities = 17/58 (29%), Positives = 25/58 (43%) Frame = -1 Query: 239 SNKKCNRYATFIDQSLRET*FR*HRWYSIISLDQSVRARTLTMSCKHEYIQSLDSTGR 66 S+ C Y F QSL + W +++S+ L + IQSLDS+ R Sbjct: 335 SHMLCIGYGRFPPQSLTDM------WLTMLSMISGATCYALFLGHATNLIQSLDSSRR 386 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 23.4 bits (48), Expect = 2.0 Identities = 17/58 (29%), Positives = 25/58 (43%) Frame = -1 Query: 239 SNKKCNRYATFIDQSLRET*FR*HRWYSIISLDQSVRARTLTMSCKHEYIQSLDSTGR 66 S+ C Y F QSL + W +++S+ L + IQSLDS+ R Sbjct: 303 SHMLCIGYGRFPPQSLTDM------WLTMLSMISGATCYALFLGHATNLIQSLDSSRR 354 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 22.6 bits (46), Expect = 3.5 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -2 Query: 403 ENNYTNCSITDRRSTRAYN 347 E N TN SIT+ AYN Sbjct: 7 ETNITNSSITETYFVSAYN 25 >DQ384991-1|ABD51779.1| 94|Apis mellifera allergen Api m 6 variant 2 precursor protein. Length = 94 Score = 21.4 bits (43), Expect = 8.2 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -3 Query: 432 PNLFSFKFITKIITPIVQLRIGGLHGRTTICV 337 PN+ KI P R+G L + +CV Sbjct: 55 PNVVPKPLCIKICAPGCVCRLGYLRNKKKVCV 86 >DQ384990-1|ABD51778.1| 92|Apis mellifera allergen Api m 6 variant 1 precursor protein. Length = 92 Score = 21.4 bits (43), Expect = 8.2 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -3 Query: 432 PNLFSFKFITKIITPIVQLRIGGLHGRTTICV 337 PN+ KI P R+G L + +CV Sbjct: 55 PNVVPKPLCIKICAPGCVCRLGYLRNKKKVCV 86 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,860 Number of Sequences: 438 Number of extensions: 3812 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20586735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -