BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1051 (677 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g09360.1 68418.m01084 laccase family protein / diphenol oxida... 28 4.9 At5g42620.1 68418.m05188 expressed protein 28 6.5 At4g17090.1 68417.m02575 beta-amylase (CT-BMY) / 1,4-alpha-D-glu... 27 8.6 At1g13110.1 68414.m01520 cytochrome P450 71B7 (CYP71B7) identica... 27 8.6 >At5g09360.1 68418.m01084 laccase family protein / diphenol oxidase family protein similar to laccase [Pinus taeda][GI:13661201] Length = 569 Score = 28.3 bits (60), Expect = 4.9 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Frame = +2 Query: 425 KFGTTFIILKYNSS**RMFQ-RRIKSLNYIGINLNNVNFNKVALGLRAVSSRITPIK 592 +FGT ++L YNSS + Q + + N I+L+ NF V G R P++ Sbjct: 441 RFGTKVVVLDYNSSVELILQGTTVWASNIHPIHLHGYNFYVVGSGFGNFDRRKDPLR 497 >At5g42620.1 68418.m05188 expressed protein Length = 841 Score = 27.9 bits (59), Expect = 6.5 Identities = 13/31 (41%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Frame = +1 Query: 43 HHIQKLDILPVESKL*MYSCLHD-IVRVRAR 132 HH Q++ + VES + +SC+HD I+ R R Sbjct: 41 HHHQRIAVEGVESGVASHSCIHDQIIEQRKR 71 >At4g17090.1 68417.m02575 beta-amylase (CT-BMY) / 1,4-alpha-D-glucan maltohydrolase identical to beta-amylase enzyme GI:6065749 from [Arabidopsis thaliana] Length = 548 Score = 27.5 bits (58), Expect = 8.6 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 Query: 76 RREGCLTSEYGGFFLHYY 23 RR+G SEYG FF+ +Y Sbjct: 325 RRDGTWNSEYGKFFMEWY 342 >At1g13110.1 68414.m01520 cytochrome P450 71B7 (CYP71B7) identical to (SP:Q96514) cytochrome P450 71B7 [Arabidopsis thaliana]; PF|00067 Cytochrome P450 family. ESTs gb|T44875, gb|T04814, gb|R65111, gb|T44310 and gb|T04541 come from this gene; identical to cDNA cytochrome P450 GI:1523795, ATCYP71B7 Length = 504 Score = 27.5 bits (58), Expect = 8.6 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -3 Query: 621 YRYIVEENNYLIGVMRDETALKPNATLLKLTLLRFI 514 +RYI EE N L+ E+ALK + LK TL + Sbjct: 144 FRYIREEENDLLIKKLTESALKKSPVNLKKTLFTLV 179 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,243,651 Number of Sequences: 28952 Number of extensions: 218120 Number of successful extensions: 401 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 395 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 401 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1428369392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -