BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1050 (719 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0078 + 31505126-31507933 28 6.5 03_06_0294 + 32893050-32893340,32894540-32895322 28 8.6 >03_06_0078 + 31505126-31507933 Length = 935 Score = 28.3 bits (60), Expect = 6.5 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +2 Query: 476 PSKEQCFTESTTRSGAFRYLKHRSPFSSNPSLET 577 P E C + +R AFR L PF +N L T Sbjct: 214 PESEYCLVFTVSRGSAFRLLAECYPFGTNKRLLT 247 >03_06_0294 + 32893050-32893340,32894540-32895322 Length = 357 Score = 27.9 bits (59), Expect = 8.6 Identities = 22/91 (24%), Positives = 39/91 (42%), Gaps = 3/91 (3%) Frame = +2 Query: 341 WSHK*SSLVIFSPYPFASSVRG-YSSFSRTGR*AYGLDLREFADTSPSKEQCFTESTTRS 517 WS +S V++ P+ F + + Y + L+ F P K + E R Sbjct: 58 WSATNNSFVVWDPHLFGNVLLPRYFKHNNFSSFVRQLNTYGFRKVDPDKWEFANEGFLRG 117 Query: 518 GA--FRYLKHRSPFSSNPSLETKGSTSKLTH 604 + +K R P +S+PS ++ GS ++ H Sbjct: 118 QKHLLKSIKRRKPPNSSPSQQSLGSFLEVGH 148 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,014,428 Number of Sequences: 37544 Number of extensions: 288736 Number of successful extensions: 668 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 654 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 668 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1874582652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -