BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1050 (719 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 23 3.8 AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase p... 22 6.7 AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase p... 22 6.7 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 8.9 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 22.6 bits (46), Expect = 3.8 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -2 Query: 523 STGPGGRFCEALLLARASVSKFS 455 S GPG ALL R SVS+ S Sbjct: 155 SCGPGAAAAAALLSKRRSVSECS 177 >AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 21.8 bits (44), Expect = 6.7 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 Query: 144 FFFVEALLFSFSKKYSCFYVTGDSK*TVY 230 +F +AL F+F KY ++ G K T + Sbjct: 83 YFPTQALNFAFKDKYKQVFLGGVDKNTQF 111 >AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 21.8 bits (44), Expect = 6.7 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 Query: 144 FFFVEALLFSFSKKYSCFYVTGDSK*TVY 230 +F +AL F+F KY ++ G K T + Sbjct: 83 YFPTQALNFAFKDKYKQVFLGGVDKNTQF 111 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.4 bits (43), Expect = 8.9 Identities = 11/44 (25%), Positives = 23/44 (52%) Frame = -3 Query: 564 GFDENGDRCLRYLKAPDLVVDSVKHCSLLGLVSANSLRSSP*AY 433 G ++NG R + ++ +S+KH ++ V+ + + SP Y Sbjct: 241 GTNKNGKFFSRSSTSRIVISESLKHFTIQSSVTTSKMMVSPRLY 284 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,769 Number of Sequences: 438 Number of extensions: 3149 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22292145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -