BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1047 (733 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8IJR2 Cluster: Putative uncharacterized protein; n=4; ... 36 1.4 UniRef50_Q3W6P5 Cluster: Putative uncharacterized protein; n=1; ... 33 7.2 UniRef50_Q8MTQ0 Cluster: Putative uncharacterized protein; n=1; ... 33 7.2 UniRef50_Q24278 Cluster: Cyclic nucleotide-gated cation channel;... 33 9.5 >UniRef50_Q8IJR2 Cluster: Putative uncharacterized protein; n=4; Plasmodium|Rep: Putative uncharacterized protein - Plasmodium falciparum (isolate 3D7) Length = 628 Score = 35.5 bits (78), Expect = 1.4 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 7/63 (11%) Frame = +3 Query: 270 NTHINISLSIKYMYFLYGYKISSKSDAWF-------SSYNGTSVKTTVDLYISIDFYFFS 428 N +IN IKY F+Y Y+I K + +F ++ NG + D+YI++D Y+ Sbjct: 105 NKYINSRQMIKYSGFIYLYEIIEKKNFYFLLHFLMTNNNNGLIIILPEDMYINVDEYYRI 164 Query: 429 KKI 437 KI Sbjct: 165 NKI 167 >UniRef50_Q3W6P5 Cluster: Putative uncharacterized protein; n=1; Frankia sp. EAN1pec|Rep: Putative uncharacterized protein - Frankia sp. EAN1pec Length = 338 Score = 33.1 bits (72), Expect = 7.2 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -2 Query: 324 IHIENTCT*WIG*YLYECWTPYTSCGGVNDENLCWGE 214 +H +N CT ++ LY P T GG + N+ WG+ Sbjct: 177 VHFQNDCTNFVSQALYAGGFPMTGYGGSSGNNVWWGD 213 >UniRef50_Q8MTQ0 Cluster: Putative uncharacterized protein; n=1; Bombyx mori|Rep: Putative uncharacterized protein - Bombyx mori (Silk moth) Length = 44 Score = 33.1 bits (72), Expect = 7.2 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -1 Query: 211 IIMFILNAQQSGRVQLVY 158 II+ ILNAQ+SGRVQLVY Sbjct: 10 IIILILNAQRSGRVQLVY 27 >UniRef50_Q24278 Cluster: Cyclic nucleotide-gated cation channel; n=6; Diptera|Rep: Cyclic nucleotide-gated cation channel - Drosophila melanogaster (Fruit fly) Length = 665 Score = 32.7 bits (71), Expect = 9.5 Identities = 17/46 (36%), Positives = 23/46 (50%) Frame = +3 Query: 306 MYFLYGYKISSKSDAWFSSYNGTSVKTTVDLYISIDFYFFSKKIIT 443 MYF Y+I SD+W + NGT T YI FY+ + + T Sbjct: 268 MYFAISYEIGFSSDSWVYNLNGTRNNTLQRQYI-YSFYWSTLTLTT 312 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 662,807,908 Number of Sequences: 1657284 Number of extensions: 12015156 Number of successful extensions: 22516 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 21920 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22515 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 59265488880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -