BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1043 (789 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC16E8.06c |nop12||RNA-binding protein Nop12|Schizosaccharomyc... 31 0.25 SPCC645.10 |||ATP|Schizosaccharomyces pombe|chr 3|||Manual 30 0.43 SPBC6B1.03c |||Pal1 family protein|Schizosaccharomyces pombe|chr... 29 0.76 SPAC17G6.03 |||phosphoprotein phosphatase|Schizosaccharomyces po... 28 1.3 SPBC17D1.06 |dbp3||ATP-dependent RNA helicase Dbp3 |Schizosaccha... 28 1.3 SPAP8A3.05 |||ski complex subunit Ski7 |Schizosaccharomyces pomb... 27 4.0 SPAP27G11.04c |||tRNA specific adenosine deaminase subunit Tad3 ... 26 5.4 SPBC29A10.10c |||tRNA-splicing endonuclease positive effector |S... 26 7.1 SPAP8A3.10 |||mitochondrial intermembrane space protein sorting ... 26 7.1 >SPAC16E8.06c |nop12||RNA-binding protein Nop12|Schizosaccharomyces pombe|chr 1|||Manual Length = 438 Score = 30.7 bits (66), Expect = 0.25 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = +2 Query: 173 ALLAAVLPSESHGERPENVLFAEMEIDKKIKVLGLQW-NPKSDSFNFKVKVSSLKCTK 343 ALL L E H +P A+ +++KK K QW N K++S K K ++ K K Sbjct: 381 ALLQQELALEGHRAKPGENPLAKKKVNKKRKERAAQWRNKKAESVGKKQKTAAGKKDK 438 >SPCC645.10 |||ATP|Schizosaccharomyces pombe|chr 3|||Manual Length = 484 Score = 29.9 bits (64), Expect = 0.43 Identities = 19/56 (33%), Positives = 34/56 (60%), Gaps = 2/56 (3%) Frame = -3 Query: 733 FEARNSETHTQRCDASFGYNQVSLNEIF-LIFVTN-IYTCSETLLGSVSKTVNLYR 572 F+ ++T T+ C +S G LN+ + ++F+T+ IY+C +T SVS T + Y+ Sbjct: 361 FDELVNDTSTKNC-SSIGSLIRQLNKSWEVVFLTSVIYSCCKTPAASVSNTFSSYK 415 >SPBC6B1.03c |||Pal1 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 272 Score = 29.1 bits (62), Expect = 0.76 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +2 Query: 545 YIFNNNNSEPIQIHGFADASEKGF 616 ++ +N N P+Q H F D EKG+ Sbjct: 7 FVHSNANFPPLQTHNFEDIPEKGY 30 >SPAC17G6.03 |||phosphoprotein phosphatase|Schizosaccharomyces pombe|chr 1|||Manual Length = 635 Score = 28.3 bits (60), Expect = 1.3 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +2 Query: 275 LQWNPKSDSFNFKVKVSSLKCTKRVILSE-IAKIYDPLGLLSPV 403 + WNP+ F+ K K SS + +S I + LGLL+P+ Sbjct: 352 IDWNPEGFMFHSKTKKSSFNTSLGEFISNGIYEARKALGLLTPI 395 >SPBC17D1.06 |dbp3||ATP-dependent RNA helicase Dbp3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 578 Score = 28.3 bits (60), Expect = 1.3 Identities = 11/42 (26%), Positives = 21/42 (50%) Frame = +3 Query: 543 VIYLTIIIPNRYKFTVLLTLPRRVSEHVYIFVTKIKKISFKL 668 ++Y+++ I N Y T L++L V H++ K K+ Sbjct: 9 ILYISLSIDNNYLVTTLISLKENVFLHIFTLTFLFKAFLLKM 50 >SPAP8A3.05 |||ski complex subunit Ski7 |Schizosaccharomyces pombe|chr 1|||Manual Length = 695 Score = 26.6 bits (56), Expect = 4.0 Identities = 9/33 (27%), Positives = 21/33 (63%) Frame = +2 Query: 413 AKHLIQLLWIAKVDWDETPPVDIVNSWSSFVDE 511 + ++ + + +++WDE +++VNS SF+ E Sbjct: 410 SSYMFAITKMDEIEWDENKFINLVNSIQSFLKE 442 >SPAP27G11.04c |||tRNA specific adenosine deaminase subunit Tad3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 315 Score = 26.2 bits (55), Expect = 5.4 Identities = 16/60 (26%), Positives = 25/60 (41%) Frame = +3 Query: 147 CANGTATRQRYSLRCCHQSLMVSGRRTFSSLKWRSTKRLRFWAYSGTLNLIHSILKSKFH 326 C+ G + L C + + G + + WR+ R+ AYSG + SI K H Sbjct: 256 CSMGLLHSRIRRLIYCKKQPLTGGIESLYGIHWRAELNHRYLAYSGWNKPVPSI-KENIH 314 >SPBC29A10.10c |||tRNA-splicing endonuclease positive effector |Schizosaccharomyces pombe|chr 2|||Manual Length = 1944 Score = 25.8 bits (54), Expect = 7.1 Identities = 22/88 (25%), Positives = 44/88 (50%) Frame = +2 Query: 245 EIDKKIKVLGLQWNPKSDSFNFKVKVSSLKCTKRVILSEIAKIYDPLGLLSPVTLFAKHL 424 ++ + KV+ L WNP +DSF+ ++C + + Y+ + P+ LF + Sbjct: 1058 DVQEFYKVI-LGWNPLADSFS--ASNVEMQCVQAKFTYNDSNAYEK--VFKPM-LFHECW 1111 Query: 425 IQLLWIAKVDWDETPPVDIVNSWSSFVD 508 Q+ + V+ + PP+D++ + S VD Sbjct: 1112 AQVK--SAVEEKQYPPIDLILNTRSTVD 1137 >SPAP8A3.10 |||mitochondrial intermembrane space protein sorting protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 171 Score = 25.8 bits (54), Expect = 7.1 Identities = 9/27 (33%), Positives = 19/27 (70%) Frame = -3 Query: 643 FVTNIYTCSETLLGSVSKTVNLYRFGI 563 F+ + CS+T++ +++K V+ RFG+ Sbjct: 111 FIQSSENCSKTIVDTIAKFVSPLRFGL 137 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,121,524 Number of Sequences: 5004 Number of extensions: 66303 Number of successful extensions: 176 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 169 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 176 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 383374054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -