BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1043 (789 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK126539-1|BAC86584.1| 550|Homo sapiens protein ( Homo sapiens ... 30 8.3 >AK126539-1|BAC86584.1| 550|Homo sapiens protein ( Homo sapiens cDNA FLJ44575 fis, clone UTERU3018154. ). Length = 550 Score = 30.3 bits (65), Expect = 8.3 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = +3 Query: 195 HQSLMVSGRRTF-SSLKWRSTKRLRFWAYSGTLNLIHS-ILKSKFHRL 332 H + +GR F + +W+ T R W + G LNL ++ S HRL Sbjct: 244 HLKVQYNGRPLFVAGGQWKDTSRATLWKWEGVLNLDSPWLMVSAAHRL 291 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,640,580 Number of Sequences: 237096 Number of extensions: 2186738 Number of successful extensions: 4857 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4682 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4857 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9646050614 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -