BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1043 (789 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g49490.1 68416.m05409 expressed protein 34 0.12 At3g21630.1 68416.m02728 protein kinase family protein contains ... 31 0.87 At4g05300.1 68417.m00803 hypothetical protein 30 2.0 At5g34838.1 68418.m04072 hypothetical protein contains Pfam doma... 29 4.6 At4g13020.2 68417.m02032 serine/threonine protein kinase (MHK) i... 28 6.1 At1g15100.1 68414.m01803 zinc finger (C3HC4-type RING finger) fa... 28 6.1 At1g08600.1 68414.m00953 SNF2 domain-containing protein / helica... 28 6.1 At3g01370.1 68416.m00059 expressed protein contains Pfam domain,... 28 8.1 At1g70640.1 68414.m08143 octicosapeptide/Phox/Bem1p (PB1) domain... 28 8.1 At1g05370.1 68414.m00544 expressed protein 28 8.1 >At3g49490.1 68416.m05409 expressed protein Length = 953 Score = 33.9 bits (74), Expect = 0.12 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Frame = +1 Query: 604 REGFRSMCIY--SLQRSRRFHSNSPDYSQNSRRTVECASHYSSPRTNGGSPL 753 +E F M +Y S QRS SN+P Y +NSR +S Y+ +G S L Sbjct: 50 KEVFDPMMLYHDSYQRSPANWSNNPSYRENSRSQTPSSSFYADNTQHGNSGL 101 >At3g21630.1 68416.m02728 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 617 Score = 31.1 bits (67), Expect = 0.87 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -3 Query: 628 YTCSETLLGSVSKTVNLYRFGIIIVKYITRK 536 Y ET+ G VS V++Y FG+++ + I+ K Sbjct: 482 YMAPETVYGEVSAKVDVYAFGVVLYELISAK 512 >At4g05300.1 68417.m00803 hypothetical protein Length = 387 Score = 29.9 bits (64), Expect = 2.0 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = +3 Query: 210 VSGRRTFSSLKW-RSTKRLRFWAYSGTLNLIHSILKSKFHRLSVQSVSFCQK*QKYTTP 383 +S T ++ +W RS + LR TLNL++ L + H +S+ + F + K TP Sbjct: 162 ISQLHTENARRWERSWRCLRVRTLYSTLNLVYRTLGNCVHNISINLIVFDVEGTKTNTP 220 >At5g34838.1 68418.m04072 hypothetical protein contains Pfam domain, PF04827: Protein of unknown function (DUF635) Length = 311 Score = 28.7 bits (61), Expect = 4.6 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +3 Query: 213 SGRRTFSSLKWRSTKRLRFWAYSGTLNL 296 +GR FS+L+ +ST +R AY GT+NL Sbjct: 44 TGRLGFSALQ-KSTAAIRMLAYEGTINL 70 >At4g13020.2 68417.m02032 serine/threonine protein kinase (MHK) identical to serine/threonine-protein kinase MHK [Arabidopsis thaliana] SWISS-PROT:P43294 Length = 443 Score = 28.3 bits (60), Expect = 6.1 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 4/44 (9%) Frame = -3 Query: 655 IFLIFVTNIYTCSETL----LGSVSKTVNLYRFGIIIVKYITRK 536 +F++FV Y E L GSV K VNL + ++ VK + RK Sbjct: 3 VFVVFVMCRYKILEELGDGTCGSVYKAVNLETYEVVAVKKMKRK 46 >At1g15100.1 68414.m01803 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 155 Score = 28.3 bits (60), Expect = 6.1 Identities = 20/64 (31%), Positives = 30/64 (46%) Frame = +2 Query: 353 LSEIAKIYDPLGLLSPVTLFAKHLIQLLWIAKVDWDETPPVDIVNSWSSFVDELPLISQI 532 LS+++ PL LLS + +F HL L + PVD V+ S + + L Q+ Sbjct: 7 LSDVSSDSIPLMLLSLLAVFINHLRSFLLRLTSKSNPNLPVDDVSIASGLANIIVLADQL 66 Query: 533 SFPR 544 S R Sbjct: 67 SLNR 70 >At1g08600.1 68414.m00953 SNF2 domain-containing protein / helicase domain-containing protein similar to SP|P46100 Transcriptional regulator ATRX {Homo sapiens}; contains PFam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain; non-consensus GC donor splice site at exon boundary 28614 Length = 1457 Score = 28.3 bits (60), Expect = 6.1 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 4/61 (6%) Frame = -2 Query: 272 PEP*SFCRSPFQRRERSPAAHHETLMAAPQRVTLASCCAIC--AIQTQP--PHKYLSALV 105 P+P F RS F R + AH TL++ +V ++ C C I+ + P LSA++ Sbjct: 1396 PQPKGFNRSRFVNRNCTRIAHQLTLISQGLKVGSSTVCGECGRVIRWEDVIPASKLSAVI 1455 Query: 104 V 102 V Sbjct: 1456 V 1456 >At3g01370.1 68416.m00059 expressed protein contains Pfam domain, PF04581: Protein of unknown function (DUF578) Length = 1011 Score = 27.9 bits (59), Expect = 8.1 Identities = 16/51 (31%), Positives = 30/51 (58%) Frame = +2 Query: 626 VYIRYKDQEDFIQTHLIIAKTRVAPLSVRLTIPRLELTAAVLLSKLIEKVM 778 + + KDQ+D IQTH + ++ R +P ++ L ++L+ A+ EKV+ Sbjct: 511 IELEAKDQKDHIQTHQMKSRQRNSPEAI-LEKTSMKLSMALEKKANAEKVL 560 >At1g70640.1 68414.m08143 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 174 Score = 27.9 bits (59), Expect = 8.1 Identities = 21/71 (29%), Positives = 35/71 (49%) Frame = -1 Query: 330 SDETLTLKLNESDLGFHCKPRTLIFLSISISAKRTFSGRSP*DSDGSTAASNAGELLCHL 151 SDE L + E DL + + +FLS + + RT + SP S S+++S + Sbjct: 80 SDEDLKNLMEEYDLAITAQVKIHVFLS-PLKSTRTTANSSPPPSTTSSSSSKS------- 131 Query: 150 RNSNPAAPQIP 118 R+ +P +P P Sbjct: 132 RSRSPPSPSTP 142 >At1g05370.1 68414.m00544 expressed protein Length = 439 Score = 27.9 bits (59), Expect = 8.1 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +1 Query: 637 LQRSRRFHSNSPDYSQNSRRTV 702 LQ S FH ++ DY+QNSRR + Sbjct: 198 LQISISFHEHTCDYTQNSRRGI 219 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,242,496 Number of Sequences: 28952 Number of extensions: 341672 Number of successful extensions: 1122 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1094 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1120 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1775300800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -