BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1042 (408 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16492| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_54752| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_20783| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_51257| Best HMM Match : Pox_F16 (HMM E-Value=4.1) 41 4e-04 SB_40765| Best HMM Match : DX (HMM E-Value=1.4) 40 8e-04 SB_43828| Best HMM Match : XPG_N (HMM E-Value=1.8) 40 0.001 SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) 40 0.001 SB_48112| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) 39 0.001 SB_14726| Best HMM Match : Ribosomal_L30 (HMM E-Value=6.6) 39 0.001 SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) 39 0.001 SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) 39 0.001 SB_58989| Best HMM Match : RVT_1 (HMM E-Value=0) 39 0.002 SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_31373| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) 38 0.003 SB_4935| Best HMM Match : Pox_F16 (HMM E-Value=5.3) 38 0.003 SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23) 38 0.003 SB_38808| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_33076| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) 38 0.003 SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_26110| Best HMM Match : HipA_C (HMM E-Value=5.5) 38 0.003 SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) 38 0.003 SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28) 38 0.003 SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1) 38 0.004 SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) 38 0.004 SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_31120| Best HMM Match : Pox_F16 (HMM E-Value=5) 37 0.007 SB_51961| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_17278| Best HMM Match : RVT_1 (HMM E-Value=0.0082) 37 0.007 SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27) 37 0.007 SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39) 37 0.007 SB_33578| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00076) 36 0.010 SB_25497| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.010 SB_14729| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.010 SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30) 36 0.017 SB_25119| Best HMM Match : Ribosomal_S27 (HMM E-Value=9.4) 36 0.017 SB_7946| Best HMM Match : DUF434 (HMM E-Value=7.5) 35 0.022 SB_31047| Best HMM Match : CHORD (HMM E-Value=6.2) 35 0.029 SB_19530| Best HMM Match : EMI (HMM E-Value=3.5) 35 0.029 SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.052 SB_40344| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.052 SB_37654| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.068 SB_19427| Best HMM Match : RVT_1 (HMM E-Value=7.5e-32) 33 0.12 SB_30049| Best HMM Match : FBA_2 (HMM E-Value=7) 31 0.27 SB_54075| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.63 SB_48543| Best HMM Match : Exo_endo_phos (HMM E-Value=7.8e-06) 30 0.63 SB_43430| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.63 SB_42334| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.63 SB_36028| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.63 SB_24690| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.63 SB_12964| Best HMM Match : RVT_1 (HMM E-Value=5.6e-31) 30 0.63 SB_9140| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.63 SB_4338| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.63 SB_2173| Best HMM Match : DUF1401 (HMM E-Value=6.3) 30 0.63 SB_50776| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.63 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.63 SB_31163| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.63 SB_7536| Best HMM Match : DUF1401 (HMM E-Value=7.9) 30 0.63 SB_2999| Best HMM Match : RVT_1 (HMM E-Value=5.6e-31) 30 0.63 SB_2489| Best HMM Match : RVT_1 (HMM E-Value=0.02) 30 0.63 SB_28584| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.84 SB_27890| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.84 SB_18718| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.84 SB_55599| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.1 SB_8907| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.1 SB_47667| Best HMM Match : Ldl_recept_a (HMM E-Value=0) 29 1.5 SB_22775| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_9550| Best HMM Match : GPS (HMM E-Value=1.6e-11) 29 1.9 SB_58576| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.6 SB_56220| Best HMM Match : RVT_1 (HMM E-Value=3.7e-16) 28 2.6 SB_48902| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.6 SB_40983| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.6 SB_40552| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.6 SB_38731| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.6 SB_34180| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.6 SB_34116| Best HMM Match : RVT_1 (HMM E-Value=0) 28 2.6 SB_33284| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.6 SB_32643| Best HMM Match : Carla_C4 (HMM E-Value=9.9) 28 2.6 SB_30890| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.6 SB_29924| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.6 SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40) 28 2.6 SB_24244| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.6 SB_22251| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.6 SB_36764| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.6 SB_36762| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.6 SB_29800| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.6 SB_24298| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.6 SB_19305| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.6 SB_14496| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.6 SB_47354| Best HMM Match : RVT_1 (HMM E-Value=2e-07) 28 3.4 SB_42160| Best HMM Match : RVT_1 (HMM E-Value=0) 28 3.4 SB_21791| Best HMM Match : V-set (HMM E-Value=1.4) 27 4.5 SB_53803| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.5 SB_25515| Best HMM Match : Complex1_LYR (HMM E-Value=9.6) 27 4.5 SB_47303| Best HMM Match : CPSF_A (HMM E-Value=0) 27 5.9 SB_42286| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.9 SB_11879| Best HMM Match : WD40 (HMM E-Value=5.8e-21) 27 5.9 SB_7292| Best HMM Match : RVT_1 (HMM E-Value=0) 27 5.9 SB_45340| Best HMM Match : RVT_1 (HMM E-Value=1.2e-15) 27 5.9 SB_26191| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.9 SB_12216| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.8 SB_2424| Best HMM Match : RVT_1 (HMM E-Value=6.2e-18) 27 7.8 SB_59146| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.8 >SB_16492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 46.0 bits (104), Expect = 1e-05 Identities = 24/79 (30%), Positives = 43/79 (54%), Gaps = 1/79 (1%) Frame = +1 Query: 115 PLGLRRDFGSLCILYRMFHGECSEELFEMI-PASRFYHRTARHRSRVHPYYLEPLRSSTV 291 PL RRD L +L+++ +G+ S L ++ PA+ Y+ H + ++ + Sbjct: 192 PLEYRRDITDLVLLFKIKNGDVSISLASLLSPATSRYNTRNYHSNNYRLFFTH----NQN 247 Query: 292 RFQRSFLPRTIRLWNELPS 348 ++ S+ PRT++LWN LPS Sbjct: 248 YYRNSYFPRTVKLWNSLPS 266 >SB_54752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 792 Score = 44.0 bits (99), Expect = 5e-05 Identities = 25/79 (31%), Positives = 43/79 (54%), Gaps = 1/79 (1%) Frame = +1 Query: 115 PLGLRRDFGSLCILYRMFHGECSEELFEMI-PASRFYHRTARHRSRVHPYYLEPLRSSTV 291 PL RRD L +L+++ +G+ S ++ PA+ Y+ + H + Y L + Sbjct: 689 PLEYRRDITDLVLLFKIKNGDVSISSASLLSPATSRYNTRSYHPNN---YRLFSTHNQNY 745 Query: 292 RFQRSFLPRTIRLWNELPS 348 ++ S+ PRT++LWN LPS Sbjct: 746 -YRNSYFPRTVKLWNSLPS 763 >SB_20783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 44.0 bits (99), Expect = 5e-05 Identities = 25/79 (31%), Positives = 43/79 (54%), Gaps = 1/79 (1%) Frame = +1 Query: 115 PLGLRRDFGSLCILYRMFHGECSEELFEMI-PASRFYHRTARHRSRVHPYYLEPLRSSTV 291 PL RRD L +L+++ +G+ S ++ PA+ Y+ + H + Y L + Sbjct: 192 PLEYRRDITDLVLLFKIKNGDVSISSASLLSPATSRYNTRSYHPNN---YRLFSTHNQNY 248 Query: 292 RFQRSFLPRTIRLWNELPS 348 ++ S+ PRT++LWN LPS Sbjct: 249 -YRNSYFPRTVKLWNSLPS 266 >SB_51257| Best HMM Match : Pox_F16 (HMM E-Value=4.1) Length = 243 Score = 40.7 bits (91), Expect = 4e-04 Identities = 25/81 (30%), Positives = 37/81 (45%) Frame = +1 Query: 112 EPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTV 291 + L +RR LC+ Y++ L + +F R R+ Y ++S+ + Sbjct: 141 DSLEVRRQLAQLCLFYKI-----RNNLVNIALPQQFQPNLRRSRTNSSKY--NQIQSNVL 193 Query: 292 RFQRSFLPRTIRLWNELPSTV 354 SF PRTIR WN LPS V Sbjct: 194 SHSYSFFPRTIRTWNLLPSEV 214 >SB_40765| Best HMM Match : DX (HMM E-Value=1.4) Length = 278 Score = 39.9 bits (89), Expect = 8e-04 Identities = 32/98 (32%), Positives = 47/98 (47%), Gaps = 1/98 (1%) Frame = +1 Query: 106 QVEPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHR-SRVHPYYLEPLRS 282 Q L LRR L +LY++ G+ + + H+ R R S YY E ++ Sbjct: 179 QWSTLELRRTMARLTLLYKLSRGQIDIDTSTYLRP----HQDLRTRNSHNFKYYQE--KA 232 Query: 283 STVRFQRSFLPRTIRLWNELPSTVFPERYDMYFFKRGL 396 + ++ SF PRTIR WN LP+ + E + FKR L Sbjct: 233 TKNKYFYSFFPRTIRHWNTLPNELV-ELDSIEHFKRDL 269 >SB_43828| Best HMM Match : XPG_N (HMM E-Value=1.8) Length = 174 Score = 39.5 bits (88), Expect = 0.001 Identities = 32/98 (32%), Positives = 47/98 (47%), Gaps = 1/98 (1%) Frame = +1 Query: 106 QVEPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHR-SRVHPYYLEPLRS 282 Q L LRR L +LY++ G+ + + H+ R R S YY E ++ Sbjct: 75 QWSTLELRRTMARLTLLYKLSRGQIDIDTSMYLRP----HQDLRTRNSHNFKYYQE--KA 128 Query: 283 STVRFQRSFLPRTIRLWNELPSTVFPERYDMYFFKRGL 396 + ++ SF PRTIR WN LP+ + E + FKR L Sbjct: 129 TKNKYFYSFFPRTIRHWNTLPNELV-ELGSIEHFKRDL 165 >SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) Length = 361 Score = 39.5 bits (88), Expect = 0.001 Identities = 32/98 (32%), Positives = 47/98 (47%), Gaps = 1/98 (1%) Frame = +1 Query: 106 QVEPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHR-SRVHPYYLEPLRS 282 Q L LRR L +LY++ G+ + + H+ R R S YY E ++ Sbjct: 262 QWSTLELRRTMARLTLLYKLSRGQIDIDTSMYLRP----HQDLRTRNSHNFKYYQE--KA 315 Query: 283 STVRFQRSFLPRTIRLWNELPSTVFPERYDMYFFKRGL 396 + ++ SF PRTIR WN LP+ + E + FKR L Sbjct: 316 TKNKYFYSFFPRTIRHWNTLPNELV-ELGSIEHFKRDL 352 >SB_48112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 232 Score = 39.5 bits (88), Expect = 0.001 Identities = 32/95 (33%), Positives = 45/95 (47%) Frame = +1 Query: 112 EPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTV 291 +PL RR SL +L + L +++ SR RT +H +Y P + T Sbjct: 144 QPLEDRRRTSSLVLLNSGLNNASILPLEDLMKPSRALPRT-QHSE----FYTIP-NARTD 197 Query: 292 RFQRSFLPRTIRLWNELPSTVFPERYDMYFFKRGL 396 ++ SFLPR +RLWN LP +V R F GL Sbjct: 198 IYKYSFLPRALRLWNNLPQSVIDMRGCPEAFHAGL 232 >SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) Length = 375 Score = 39.1 bits (87), Expect = 0.001 Identities = 32/98 (32%), Positives = 47/98 (47%), Gaps = 1/98 (1%) Frame = +1 Query: 106 QVEPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHR-SRVHPYYLEPLRS 282 Q L LRR L +LY++ G+ + + H+ R R S YY E ++ Sbjct: 276 QWSTLELRRTMARLTLLYKLSRGQIDIDTNMYLRP----HQDLRTRNSHNFKYYQE--KA 329 Query: 283 STVRFQRSFLPRTIRLWNELPSTVFPERYDMYFFKRGL 396 + ++ SF PRTIR WN LP+ + E + FKR L Sbjct: 330 TKNKYFYSFFPRTIRHWNTLPNELV-ELGSIEHFKRDL 366 >SB_14726| Best HMM Match : Ribosomal_L30 (HMM E-Value=6.6) Length = 231 Score = 39.1 bits (87), Expect = 0.001 Identities = 31/95 (32%), Positives = 42/95 (44%) Frame = +1 Query: 112 EPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTV 291 +PL RR SL +L + L ++ SR RT H + L + T Sbjct: 143 QPLEDRRRTSSLVLLNSGLNNASILPLEDLRKPSRALPRTQ------HSEFYTILNARTD 196 Query: 292 RFQRSFLPRTIRLWNELPSTVFPERYDMYFFKRGL 396 ++ SFLPR +RLWN LP +V R F GL Sbjct: 197 IYKYSFLPRALRLWNNLPQSVIDMRGCPEAFHSGL 231 >SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 581 Score = 39.1 bits (87), Expect = 0.001 Identities = 32/98 (32%), Positives = 47/98 (47%), Gaps = 1/98 (1%) Frame = +1 Query: 106 QVEPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHR-SRVHPYYLEPLRS 282 Q L LRR L +LY++ G+ + + H+ R R S YY E ++ Sbjct: 482 QWSTLELRRTMARLTLLYKLSRGQIDIDTNMYLRP----HQDLRTRNSHNFKYYQE--KA 535 Query: 283 STVRFQRSFLPRTIRLWNELPSTVFPERYDMYFFKRGL 396 + ++ SF PRTIR WN LP+ + E + FKR L Sbjct: 536 TKNKYFYSFFPRTIRHWNTLPNELV-ELGSIEHFKRDL 572 >SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 666 Score = 39.1 bits (87), Expect = 0.001 Identities = 31/94 (32%), Positives = 46/94 (48%), Gaps = 1/94 (1%) Frame = +1 Query: 118 LGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHR-SRVHPYYLEPLRSSTVR 294 L LRR L +LY++ G+ + + H+ R R S YY E +++ + Sbjct: 571 LELRRTMARLTLLYKLSRGQIDIDTSMYLRP----HQDLRTRNSHNFKYYQE--KATKNK 624 Query: 295 FQRSFLPRTIRLWNELPSTVFPERYDMYFFKRGL 396 + SF PRTIR WN LP+ + E + FKR L Sbjct: 625 YFYSFFPRTIRHWNTLPNELV-ELGSIEHFKRDL 657 >SB_58989| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 885 Score = 38.7 bits (86), Expect = 0.002 Identities = 21/57 (36%), Positives = 28/57 (49%) Frame = +1 Query: 235 RHRSRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMYFFKRGLWRV 405 R R HP PL +S+ SF RTI WN LP+ +F E + FK + R+ Sbjct: 823 RKTRRSHPESFIPLSTSSASEHLSFFSRTIIQWNNLPALLFNEPCSLPIFKDKISRL 879 >SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 918 Score = 37.9 bits (84), Expect = 0.003 Identities = 24/81 (29%), Positives = 36/81 (44%) Frame = +1 Query: 112 EPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTV 291 + L +RR LC+ Y++ L + +F R+ Y ++S+ + Sbjct: 816 DSLEVRRQLAQLCLFYKI-----RNNLVNIALPQQFQPNLRPSRTNSSKY--NQIQSNVL 868 Query: 292 RFQRSFLPRTIRLWNELPSTV 354 SF PRTIR WN LPS V Sbjct: 869 SHSYSFFPRTIRTWNLLPSEV 889 >SB_31373| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) Length = 198 Score = 37.9 bits (84), Expect = 0.003 Identities = 24/81 (29%), Positives = 36/81 (44%) Frame = +1 Query: 112 EPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTV 291 + L +RR LC+ Y++ L + +F R+ Y ++S+ + Sbjct: 96 DSLEVRRQLAQLCLFYKI-----RNNLVNIALPQQFQPNLRPSRTNSSKY--NQIQSNVL 148 Query: 292 RFQRSFLPRTIRLWNELPSTV 354 SF PRTIR WN LPS V Sbjct: 149 SHSYSFFPRTIRTWNLLPSEV 169 >SB_4935| Best HMM Match : Pox_F16 (HMM E-Value=5.3) Length = 243 Score = 37.9 bits (84), Expect = 0.003 Identities = 24/81 (29%), Positives = 36/81 (44%) Frame = +1 Query: 112 EPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTV 291 + L +RR LC+ Y++ L + +F R+ Y ++S+ + Sbjct: 141 DSLEVRRQLAQLCLFYKI-----RNNLVNIALPQQFQPNLRPSRTNSSKY--NQIQSNVL 193 Query: 292 RFQRSFLPRTIRLWNELPSTV 354 SF PRTIR WN LPS V Sbjct: 194 SHSYSFFPRTIRTWNLLPSEV 214 >SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23) Length = 2386 Score = 37.9 bits (84), Expect = 0.003 Identities = 24/81 (29%), Positives = 36/81 (44%) Frame = +1 Query: 112 EPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTV 291 + L +RR LC+ Y++ L + +F R+ Y ++S+ + Sbjct: 403 DSLEVRRQLAQLCLFYKI-----RNNLVNIALPQQFQPNLRPSRTNSSKY--NQIQSNVL 455 Query: 292 RFQRSFLPRTIRLWNELPSTV 354 SF PRTIR WN LPS V Sbjct: 456 SHSYSFFPRTIRTWNLLPSEV 476 >SB_38808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 824 Score = 37.9 bits (84), Expect = 0.003 Identities = 29/97 (29%), Positives = 46/97 (47%) Frame = +1 Query: 106 QVEPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSS 285 Q L LRR L +LY++ G+ + + H+ R R+ H + +++ Sbjct: 725 QWSTLELRRTMARLTLLYKLSRGQIDIDTNMYLRP----HQDLRTRNS-HNFKCYQEKAT 779 Query: 286 TVRFQRSFLPRTIRLWNELPSTVFPERYDMYFFKRGL 396 ++ SF PRTIR WN LP+ + E + FKR L Sbjct: 780 KNKYFYSFFPRTIRHWNTLPNELV-ELGSIEHFKRDL 815 >SB_33076| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) Length = 152 Score = 37.9 bits (84), Expect = 0.003 Identities = 24/81 (29%), Positives = 36/81 (44%) Frame = +1 Query: 112 EPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTV 291 + L +RR LC+ Y++ L + +F R+ Y ++S+ + Sbjct: 50 DSLEVRRQLAQLCLFYKI-----RNNLVNIALPQQFQPNLRPSRTNSSKY--NQIQSNVL 102 Query: 292 RFQRSFLPRTIRLWNELPSTV 354 SF PRTIR WN LPS V Sbjct: 103 SHSYSFFPRTIRTWNLLPSEV 123 >SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 788 Score = 37.9 bits (84), Expect = 0.003 Identities = 24/81 (29%), Positives = 36/81 (44%) Frame = +1 Query: 112 EPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTV 291 + L +RR LC+ Y++ L + +F R+ Y ++S+ + Sbjct: 507 DSLEVRRQLAQLCLFYKI-----RNNLVNIALPQQFQPNLRPSRTNSSKY--NQIQSNVL 559 Query: 292 RFQRSFLPRTIRLWNELPSTV 354 SF PRTIR WN LPS V Sbjct: 560 SHSYSFFPRTIRTWNLLPSEV 580 >SB_26110| Best HMM Match : HipA_C (HMM E-Value=5.5) Length = 210 Score = 37.9 bits (84), Expect = 0.003 Identities = 25/76 (32%), Positives = 38/76 (50%) Frame = +1 Query: 127 RRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVRFQRS 306 +R S IL+ FH ++ +P R+ R R YY + L+++T+ F S Sbjct: 112 QRRLTSQAILFYKFHNSL---IYAKLPD--LVTRSTRSTRRKELYYNQ-LQANTLAFNYS 165 Query: 307 FLPRTIRLWNELPSTV 354 F R IR+WN LP+ V Sbjct: 166 FFARAIRIWNLLPNDV 181 >SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) Length = 837 Score = 37.9 bits (84), Expect = 0.003 Identities = 24/81 (29%), Positives = 36/81 (44%) Frame = +1 Query: 112 EPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTV 291 + L +RR LC+ Y++ L + +F R+ Y ++S+ + Sbjct: 735 DSLEVRRQLAQLCLFYKI-----RNNLVNIALPQQFQPNLRPSRTNSSKY--NQIQSNVL 787 Query: 292 RFQRSFLPRTIRLWNELPSTV 354 SF PRTIR WN LPS V Sbjct: 788 SHSYSFFPRTIRTWNLLPSEV 808 >SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28) Length = 570 Score = 37.9 bits (84), Expect = 0.003 Identities = 25/76 (32%), Positives = 38/76 (50%) Frame = +1 Query: 127 RRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVRFQRS 306 +R S IL+ FH ++ +P R+ R R YY + L+++T+ F S Sbjct: 472 QRRLTSQAILFYKFHNSL---IYAKLPD--LVTRSTRSTRRKELYYNQ-LQANTLAFNYS 525 Query: 307 FLPRTIRLWNELPSTV 354 F R IR+WN LP+ V Sbjct: 526 FFARAIRIWNLLPNDV 541 >SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1) Length = 2075 Score = 37.5 bits (83), Expect = 0.004 Identities = 21/51 (41%), Positives = 27/51 (52%) Frame = +1 Query: 244 SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMYFFKRGL 396 SR H L+++ + F SF PRTIR WN LP+ V D+ FK L Sbjct: 1627 SRRHSRTYHQLQANILAFNYSFFPRTIRTWNLLPAEVV-NAADLPSFKSAL 1676 >SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) Length = 609 Score = 37.5 bits (83), Expect = 0.004 Identities = 27/82 (32%), Positives = 40/82 (48%), Gaps = 1/82 (1%) Frame = +1 Query: 106 QVEPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHR-SRVHPYYLEPLRS 282 Q L LRR L +LY++ G+ + + H+ R R S YY E ++ Sbjct: 508 QWSTLELRRTMARLTLLYKLSRGQIDIDTSMYLRP----HQDLRTRNSHNFKYYQE--KA 561 Query: 283 STVRFQRSFLPRTIRLWNELPS 348 + ++ SF PRTIR WN LP+ Sbjct: 562 TKNKYFYSFFPRTIRHWNTLPN 583 >SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3142 Score = 37.5 bits (83), Expect = 0.004 Identities = 21/51 (41%), Positives = 27/51 (52%) Frame = +1 Query: 244 SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMYFFKRGL 396 SR H L+++ + F SF PRTIR WN LP+ V D+ FK L Sbjct: 1073 SRRHSRTYHQLQANILAFNYSFFPRTIRTWNLLPAEVV-NAADLPSFKSAL 1122 >SB_31120| Best HMM Match : Pox_F16 (HMM E-Value=5) Length = 284 Score = 36.7 bits (81), Expect = 0.007 Identities = 23/81 (28%), Positives = 36/81 (44%) Frame = +1 Query: 112 EPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTV 291 + L +RR LC+ Y++ L + +F R+ Y ++S+ + Sbjct: 182 DSLEVRRQLAQLCLFYKI-----RNNLVNIALPQQFQPNLRPSRTNSSKY--NQIQSNVL 234 Query: 292 RFQRSFLPRTIRLWNELPSTV 354 SF PRTIR WN LP+ V Sbjct: 235 SHSYSFFPRTIRTWNLLPAQV 255 >SB_51961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 36.7 bits (81), Expect = 0.007 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = +1 Query: 244 SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTV 354 +R H + L+S+ + + SF PR IR+WN LPS V Sbjct: 122 TRRHNHSFLQLQSNILSYNYSFFPRAIRIWNLLPSNV 158 >SB_17278| Best HMM Match : RVT_1 (HMM E-Value=0.0082) Length = 506 Score = 36.7 bits (81), Expect = 0.007 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = +1 Query: 244 SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTV 354 +R H + L+S+ + + SF PR IR+WN LPS V Sbjct: 441 TRRHNHSFLQLQSNILSYNYSFFPRAIRIWNLLPSNV 477 >SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27) Length = 1492 Score = 36.7 bits (81), Expect = 0.007 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = +1 Query: 244 SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTV 354 +R H + L+S+ + + SF PR IR+WN LPS V Sbjct: 1427 TRRHNHSFLQLQSNILSYNYSFFPRAIRIWNLLPSNV 1463 >SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39) Length = 452 Score = 36.7 bits (81), Expect = 0.007 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = +1 Query: 244 SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTV 354 +R H + L+S+ + + SF PR IR+WN LPS V Sbjct: 387 TRRHNHSFLQLQSNILSYNYSFFPRAIRIWNLLPSNV 423 >SB_33578| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00076) Length = 888 Score = 36.3 bits (80), Expect = 0.010 Identities = 20/56 (35%), Positives = 26/56 (46%) Frame = +1 Query: 202 IPASRFYHRTARHRSRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERY 369 +P S R HP + + + T F+ SF+PR IRLWN L TV Y Sbjct: 713 LPLSTLSKPLRRSERTSHPEHYDIPYARTNIFKYSFVPRAIRLWNSLEVTVVLAAY 768 >SB_25497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 36.3 bits (80), Expect = 0.010 Identities = 18/43 (41%), Positives = 26/43 (60%) Frame = +1 Query: 226 RTARHRSRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTV 354 R+ R R YY + L+++T+ F SF R IR+WN LP+ V Sbjct: 294 RSTRSTRRKELYYNQ-LQANTLAFNYSFFARAIRIWNLLPNDV 335 >SB_14729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 36.3 bits (80), Expect = 0.010 Identities = 18/43 (41%), Positives = 26/43 (60%) Frame = +1 Query: 226 RTARHRSRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTV 354 R+ R R YY + L+++T+ F SF R IR+WN LP+ V Sbjct: 245 RSTRSTRRKELYYNQ-LQANTLAFNYSFFARAIRIWNLLPNDV 286 >SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30) Length = 1280 Score = 35.5 bits (78), Expect = 0.017 Identities = 24/76 (31%), Positives = 36/76 (47%) Frame = +1 Query: 127 RRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVRFQRS 306 +R S IL+ FH ++ +P R+ R R Y L+++T+ F S Sbjct: 1182 QRRLTSQAILFYKFHNSL---IYAKLPD--LVTRSTRSTRRKE-LYCNQLQANTLTFNYS 1235 Query: 307 FLPRTIRLWNELPSTV 354 F R IR+WN LP+ V Sbjct: 1236 FFARAIRIWNLLPNDV 1251 >SB_25119| Best HMM Match : Ribosomal_S27 (HMM E-Value=9.4) Length = 443 Score = 35.5 bits (78), Expect = 0.017 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +1 Query: 244 SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTV 354 +R H + L S+ + F SF PR IR WN LP + Sbjct: 262 TRRHSLSFQQLHSNILSFNYSFFPRAIRAWNLLPDNI 298 >SB_7946| Best HMM Match : DUF434 (HMM E-Value=7.5) Length = 294 Score = 35.1 bits (77), Expect = 0.022 Identities = 25/77 (32%), Positives = 38/77 (49%) Frame = +1 Query: 115 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVR 294 PL RR L + Y+ + + + E+ + I RT + RS HP L +T Sbjct: 205 PLSKRRQNARLTLFYKAVNKKSALEIPDNID-----RRTRQLRSS-HPDKFIELCPTTEA 258 Query: 295 FQRSFLPRTIRLWNELP 345 ++ SF RTI+ WN+LP Sbjct: 259 YKNSFFCRTIKEWNKLP 275 >SB_31047| Best HMM Match : CHORD (HMM E-Value=6.2) Length = 251 Score = 34.7 bits (76), Expect = 0.029 Identities = 23/76 (30%), Positives = 34/76 (44%) Frame = +1 Query: 118 LGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVRF 297 L +RR L + Y++ HG + +P R + +S Y P S+ Sbjct: 160 LEIRRKRARLLMFYKIHHGLVVTDGLPAVPPMYIISRHMKSQS-----YKVPPSSTDYHK 214 Query: 298 QRSFLPRTIRLWNELP 345 ++SF P TIR WN LP Sbjct: 215 KKSFFPPTIRDWNCLP 230 >SB_19530| Best HMM Match : EMI (HMM E-Value=3.5) Length = 244 Score = 34.7 bits (76), Expect = 0.029 Identities = 26/85 (30%), Positives = 36/85 (42%), Gaps = 1/85 (1%) Frame = +1 Query: 127 RRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVRFQRS 306 RR+ L YR+ G SE + Y T ++ HP + T F+ S Sbjct: 161 RREKARLAFFYRINKG-LSEISMPPYATPQMYTITRQY----HPQRFALVSCKTNVFKES 215 Query: 307 FLPRTIRLWNELP-STVFPERYDMY 378 F P IR+WN LP ST+ D + Sbjct: 216 FFPHAIRMWNGLPVSTITQPTIDTF 240 >SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 662 Score = 33.9 bits (74), Expect = 0.052 Identities = 26/85 (30%), Positives = 36/85 (42%), Gaps = 1/85 (1%) Frame = +1 Query: 127 RRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVRFQRS 306 RR+ L YR+ G SE + Y T ++ HP + T F+ S Sbjct: 579 RREKARLAFFYRINKG-LSEISTPPYATPQMYTITRQY----HPQRFALVSCKTNVFKES 633 Query: 307 FLPRTIRLWNELP-STVFPERYDMY 378 F P IR+WN LP ST+ D + Sbjct: 634 FFPHAIRMWNGLPVSTITQPTIDTF 658 >SB_40344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 33.9 bits (74), Expect = 0.052 Identities = 25/77 (32%), Positives = 37/77 (48%) Frame = +1 Query: 115 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVR 294 PL RR L + Y+ + + + ++ + I RT + RS HP L T Sbjct: 314 PLSKRRQDARLTLFYKAVNKKSALKIPDNID-----RRTRQLRSS-HPDKFIELCPRTEA 367 Query: 295 FQRSFLPRTIRLWNELP 345 F+ SF RTI+ WN+LP Sbjct: 368 FKNSFFCRTIKEWNKLP 384 >SB_37654| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 865 Score = 33.5 bits (73), Expect = 0.068 Identities = 21/78 (26%), Positives = 32/78 (41%) Frame = +1 Query: 127 RRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVRFQRS 306 RR L + Y++ G + + + T + + L P + + F S Sbjct: 772 RRIVSDLALFYKINSGLVKIDFLPDVSPKPAVYFTRTSACNSYQFSLLPAKINAFLF--S 829 Query: 307 FLPRTIRLWNELPSTVFP 360 F RTI +WN LP VFP Sbjct: 830 FYSRTIPVWNALPQAVFP 847 >SB_19427| Best HMM Match : RVT_1 (HMM E-Value=7.5e-32) Length = 698 Score = 32.7 bits (71), Expect = 0.12 Identities = 23/77 (29%), Positives = 39/77 (50%) Frame = +1 Query: 115 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVR 294 PL RR L + Y+ + + + ++ + I RT + RS + ++E L T Sbjct: 611 PLSKRRQDARLTLFYKAVNKKSALKIPDNID-----RRTRQLRSSLPDKFIE-LCPRTEA 664 Query: 295 FQRSFLPRTIRLWNELP 345 ++ SF RTI+ WN+LP Sbjct: 665 YKNSFFCRTIKEWNKLP 681 >SB_30049| Best HMM Match : FBA_2 (HMM E-Value=7) Length = 282 Score = 31.5 bits (68), Expect = 0.27 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +1 Query: 274 LRSSTVRFQRSFLPRTIRLWNELPSTV 354 L+S+ + + SF R IR+WN LPS V Sbjct: 227 LQSNILSYNYSFFARAIRIWNLLPSNV 253 >SB_54075| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 729 Score = 30.3 bits (65), Expect = 0.63 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 115 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVR 294 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 281 PVASRIDFKILTITHKALHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 337 Query: 295 FQRSFLPRTIRLWNELP 345 RSF +LWN LP Sbjct: 338 GDRSFSNFAAKLWNSLP 354 >SB_48543| Best HMM Match : Exo_endo_phos (HMM E-Value=7.8e-06) Length = 768 Score = 30.3 bits (65), Expect = 0.63 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 115 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVR 294 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 668 PVASRIDFKILTITHKALHNQAPEYITELLTP---YTPSLSLRSANKNLLVIPKSRTKTY 724 Query: 295 FQRSFLPRTIRLWNELP 345 RSF +LWN LP Sbjct: 725 GDRSFSNFAAKLWNSLP 741 >SB_43430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 30.3 bits (65), Expect = 0.63 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 115 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVR 294 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 49 PVASRIDFKILTITHKALHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 105 Query: 295 FQRSFLPRTIRLWNELP 345 RSF +LWN LP Sbjct: 106 GDRSFSNFAAKLWNSLP 122 >SB_42334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 30.3 bits (65), Expect = 0.63 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 115 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVR 294 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 49 PVASRIDFKILTITHKALHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 105 Query: 295 FQRSFLPRTIRLWNELP 345 RSF +LWN LP Sbjct: 106 GDRSFSNFAAKLWNSLP 122 >SB_36028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 30.3 bits (65), Expect = 0.63 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 115 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVR 294 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 80 PVASRIDFKILTITHKALHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 136 Query: 295 FQRSFLPRTIRLWNELP 345 RSF +LWN LP Sbjct: 137 GDRSFSNFAAKLWNSLP 153 >SB_24690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 30.3 bits (65), Expect = 0.63 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 115 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVR 294 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 92 PVASRIDFKILTITHKALHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 148 Query: 295 FQRSFLPRTIRLWNELP 345 RSF +LWN LP Sbjct: 149 GDRSFSNFAAKLWNSLP 165 >SB_12964| Best HMM Match : RVT_1 (HMM E-Value=5.6e-31) Length = 1273 Score = 30.3 bits (65), Expect = 0.63 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 115 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVR 294 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 556 PVASRIDFKILTITHKALHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 612 Query: 295 FQRSFLPRTIRLWNELP 345 RSF +LWN LP Sbjct: 613 GDRSFSNFAAKLWNSLP 629 >SB_9140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 30.3 bits (65), Expect = 0.63 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 115 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVR 294 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 49 PVASRIDFEILTITHKALHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 105 Query: 295 FQRSFLPRTIRLWNELP 345 RSF +LWN LP Sbjct: 106 GDRSFSNFAAKLWNSLP 122 >SB_4338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 541 Score = 30.3 bits (65), Expect = 0.63 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 115 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVR 294 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 441 PVASRIDFKILTITHKALHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 497 Query: 295 FQRSFLPRTIRLWNELP 345 RSF +LWN LP Sbjct: 498 GDRSFSNFAAKLWNSLP 514 >SB_2173| Best HMM Match : DUF1401 (HMM E-Value=6.3) Length = 275 Score = 30.3 bits (65), Expect = 0.63 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 115 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVR 294 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 184 PVASRIDFKILTITHKALHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 240 Query: 295 FQRSFLPRTIRLWNELP 345 RSF +LWN LP Sbjct: 241 GDRSFSNFAAKLWNSLP 257 >SB_50776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 30.3 bits (65), Expect = 0.63 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 115 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVR 294 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 184 PVASRIDFKILTITHKALHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 240 Query: 295 FQRSFLPRTIRLWNELP 345 RSF +LWN LP Sbjct: 241 GDRSFSNFAAKLWNSLP 257 >SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 30.3 bits (65), Expect = 0.63 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 115 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVR 294 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 84 PVASRIDFKILTITHKALHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 140 Query: 295 FQRSFLPRTIRLWNELP 345 RSF +LWN LP Sbjct: 141 GDRSFSNFAAKLWNSLP 157 >SB_31163| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 30.3 bits (65), Expect = 0.63 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 115 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVR 294 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 49 PVASRIDFKILTITHKALHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 105 Query: 295 FQRSFLPRTIRLWNELP 345 RSF +LWN LP Sbjct: 106 GDRSFSNFAAKLWNSLP 122 >SB_7536| Best HMM Match : DUF1401 (HMM E-Value=7.9) Length = 180 Score = 30.3 bits (65), Expect = 0.63 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 115 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVR 294 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 80 PVASRIDFKILTITHKALHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 136 Query: 295 FQRSFLPRTIRLWNELP 345 RSF +LWN LP Sbjct: 137 GDRSFSNFAAKLWNSLP 153 >SB_2999| Best HMM Match : RVT_1 (HMM E-Value=5.6e-31) Length = 630 Score = 30.3 bits (65), Expect = 0.63 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 115 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVR 294 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 530 PVASRIDFKILTITHKALHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 586 Query: 295 FQRSFLPRTIRLWNELP 345 RSF +LWN LP Sbjct: 587 GDRSFSNFAAKLWNSLP 603 >SB_2489| Best HMM Match : RVT_1 (HMM E-Value=0.02) Length = 385 Score = 30.3 bits (65), Expect = 0.63 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 115 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVR 294 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 285 PVASRIDFKILTITHKALHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 341 Query: 295 FQRSFLPRTIRLWNELP 345 RSF +LWN LP Sbjct: 342 GDRSFSNFAAKLWNSLP 358 >SB_28584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 29.9 bits (64), Expect = 0.84 Identities = 18/75 (24%), Positives = 35/75 (46%), Gaps = 2/75 (2%) Frame = +1 Query: 136 FGSLC-ILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVRFQRSFL 312 F S+C ++Y +G + + ++ H S + +Y++ S + QR+ Sbjct: 69 FESVCHLMYDTRNGTAPPNILNLFTDTKSVHSYNTRSSTSNKFYIQ---KSRLEIQRNSF 125 Query: 313 PRT-IRLWNELPSTV 354 R R+WNELP ++ Sbjct: 126 SRVGARVWNELPQSL 140 >SB_27890| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 520 Score = 29.9 bits (64), Expect = 0.84 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 115 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVR 294 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 65 PVASRIDFKILTITHKALHNQALEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 121 Query: 295 FQRSFLPRTIRLWNELP 345 RSF +LWN LP Sbjct: 122 GDRSFSNFAAKLWNSLP 138 >SB_18718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 29.9 bits (64), Expect = 0.84 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 115 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVR 294 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 92 PVASRIDFKILTITHKALHNQALEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 148 Query: 295 FQRSFLPRTIRLWNELP 345 RSF +LWN LP Sbjct: 149 GDRSFSNFAAKLWNSLP 165 >SB_55599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 988 Score = 29.5 bits (63), Expect = 1.1 Identities = 21/77 (27%), Positives = 32/77 (41%) Frame = +1 Query: 115 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVR 294 P+ R DF L I ++ H + E + E++ Y + RS + P + Sbjct: 441 PVASRIDFKILTITHKGLHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 497 Query: 295 FQRSFLPRTIRLWNELP 345 RSF +LWN LP Sbjct: 498 GDRSFSNIAAKLWNSLP 514 >SB_8907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 776 Score = 29.5 bits (63), Expect = 1.1 Identities = 20/77 (25%), Positives = 32/77 (41%) Frame = +1 Query: 115 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVR 294 P+ + DF L I ++ H + E + E++ Y + RS + P + Sbjct: 690 PVATKIDFKILIITHKALHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTY 746 Query: 295 FQRSFLPRTIRLWNELP 345 RSF +LWN LP Sbjct: 747 GDRSFSNFAAKLWNSLP 763 >SB_47667| Best HMM Match : Ldl_recept_a (HMM E-Value=0) Length = 3891 Score = 29.1 bits (62), Expect = 1.5 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 Query: 311 CHVPSGYGMSSPPRCFPSAMTCTSSNEA 394 C P GY + +P RC S +C SS A Sbjct: 2147 CSCPQGYRLENPYRCVLSNASCASSEFA 2174 >SB_22775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 29.1 bits (62), Expect = 1.5 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 274 LRSSTVRFQRSFLPRTIRLWN 336 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFDMSFIPRTIRTWN 124 >SB_9550| Best HMM Match : GPS (HMM E-Value=1.6e-11) Length = 1771 Score = 28.7 bits (61), Expect = 1.9 Identities = 22/78 (28%), Positives = 34/78 (43%), Gaps = 1/78 (1%) Frame = +1 Query: 115 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVR 294 P+ R DF L I + H + E + E++ + +R V+ L +S T Sbjct: 1677 PVATRIDFKILTITHIALHNQAPEYITELLTP----YTPSRSLRSVNKNLLVIPKSRTKT 1732 Query: 295 F-QRSFLPRTIRLWNELP 345 + RSF +LWN LP Sbjct: 1733 YGDRSFSNFAAKLWNSLP 1750 >SB_58576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 2.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 274 LRSSTVRFQRSFLPRTIRLWN 336 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_56220| Best HMM Match : RVT_1 (HMM E-Value=3.7e-16) Length = 453 Score = 28.3 bits (60), Expect = 2.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 274 LRSSTVRFQRSFLPRTIRLWN 336 L+++ F SF+PRTIR WN Sbjct: 398 LQANVNAFGMSFIPRTIRTWN 418 >SB_48902| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 2.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 274 LRSSTVRFQRSFLPRTIRLWN 336 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_40983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 2.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 274 LRSSTVRFQRSFLPRTIRLWN 336 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_40552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 2.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 274 LRSSTVRFQRSFLPRTIRLWN 336 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_38731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 2.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 274 LRSSTVRFQRSFLPRTIRLWN 336 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_34180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 2.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 274 LRSSTVRFQRSFLPRTIRLWN 336 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_34116| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 522 Score = 28.3 bits (60), Expect = 2.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 274 LRSSTVRFQRSFLPRTIRLWN 336 L+++ F SF+PRTIR WN Sbjct: 467 LQANVNAFGMSFIPRTIRTWN 487 >SB_33284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 28.3 bits (60), Expect = 2.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 274 LRSSTVRFQRSFLPRTIRLWN 336 L+++ F SF+PRTIR WN Sbjct: 208 LQANVNAFGMSFIPRTIRTWN 228 >SB_32643| Best HMM Match : Carla_C4 (HMM E-Value=9.9) Length = 159 Score = 28.3 bits (60), Expect = 2.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 274 LRSSTVRFQRSFLPRTIRLWN 336 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_30890| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 2.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 274 LRSSTVRFQRSFLPRTIRLWN 336 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_29924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 2.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 274 LRSSTVRFQRSFLPRTIRLWN 336 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40) Length = 892 Score = 28.3 bits (60), Expect = 2.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 274 LRSSTVRFQRSFLPRTIRLWN 336 L+++ F SF+PRTIR WN Sbjct: 837 LQANVNAFGMSFIPRTIRTWN 857 >SB_24244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 2.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 274 LRSSTVRFQRSFLPRTIRLWN 336 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_22251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 497 Score = 28.3 bits (60), Expect = 2.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 274 LRSSTVRFQRSFLPRTIRLWN 336 L+++ F SF+PRTIR WN Sbjct: 442 LQANVNAFGMSFIPRTIRTWN 462 >SB_36764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 2.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 274 LRSSTVRFQRSFLPRTIRLWN 336 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_36762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 2.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 274 LRSSTVRFQRSFLPRTIRLWN 336 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_29800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 2.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 274 LRSSTVRFQRSFLPRTIRLWN 336 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_24298| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 2.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 274 LRSSTVRFQRSFLPRTIRLWN 336 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_19305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 2.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 274 LRSSTVRFQRSFLPRTIRLWN 336 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_14496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 28.3 bits (60), Expect = 2.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 274 LRSSTVRFQRSFLPRTIRLWN 336 L+++ F SF+PRTIR WN Sbjct: 55 LQANVNAFGMSFIPRTIRTWN 75 >SB_47354| Best HMM Match : RVT_1 (HMM E-Value=2e-07) Length = 773 Score = 27.9 bits (59), Expect = 3.4 Identities = 23/78 (29%), Positives = 34/78 (43%), Gaps = 1/78 (1%) Frame = +1 Query: 115 PLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVR 294 P+ R DF L I ++ H + E + E++ Y +A V P +S T Sbjct: 678 PVASRIDFKILTITHKALHNQAPEYITELLTP---YTPSANKNLLVIP------KSRTKT 728 Query: 295 F-QRSFLPRTIRLWNELP 345 + RSF +LWN LP Sbjct: 729 YGDRSFSNFAAKLWNSLP 746 >SB_42160| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1858 Score = 27.9 bits (59), Expect = 3.4 Identities = 20/73 (27%), Positives = 30/73 (41%) Frame = +1 Query: 127 RRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVRFQRS 306 R DF L I ++ H + E + E++ Y + RS + P + RS Sbjct: 361 RIDFKILTITHKALHNQAPEYITELLTP---YTPSRSLRSANKNLLVIPKSRTKTYGDRS 417 Query: 307 FLPRTIRLWNELP 345 F +LWN LP Sbjct: 418 FSNFAAKLWNSLP 430 >SB_21791| Best HMM Match : V-set (HMM E-Value=1.4) Length = 474 Score = 27.5 bits (58), Expect = 4.5 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = -3 Query: 226 DGKNEMLVSSRTIPQSTPHGTYGTKYRGNRSPSADPEAP 110 DG+ ++ S+ +P+ PH + YR N S S +P +P Sbjct: 139 DGRYVIVGSASYVPED-PHPFFFDIYRNNESVSPNPRSP 176 >SB_53803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 619 Score = 27.5 bits (58), Expect = 4.5 Identities = 23/72 (31%), Positives = 33/72 (45%) Frame = +2 Query: 140 VPSVFCTVCSMGSALRNCSR*YQHLVFTIAPPATGVEFIHTTWSHCGHPQCVSRDLFCHV 319 VP+V TV ++ S + N ++VF+ P G IH+T CG PQC C + Sbjct: 393 VPNVVFTVPNVVSTVPNVVSTVPNVVFS---PQCG---IHST--QCGSPQCGIHSTQCGI 444 Query: 320 PSGYGMSSPPRC 355 S P+C Sbjct: 445 HSTQCGIHSPQC 456 >SB_25515| Best HMM Match : Complex1_LYR (HMM E-Value=9.6) Length = 304 Score = 27.5 bits (58), Expect = 4.5 Identities = 23/81 (28%), Positives = 33/81 (40%) Frame = +1 Query: 103 HQVEPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRS 282 HQ+E LRR + Y++ HG + + + T L P Sbjct: 206 HQLE---LRRTVFDSVMFYKIHHGLVKIDFPSDVIRKPGSYATRSSVRNTCQLTLPP--P 260 Query: 283 STVRFQRSFLPRTIRLWNELP 345 S +F+ SF RTI +WN LP Sbjct: 261 SINQFKYSFFSRTIPVWNSLP 281 >SB_47303| Best HMM Match : CPSF_A (HMM E-Value=0) Length = 1291 Score = 27.1 bits (57), Expect = 5.9 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 8/42 (19%) Frame = +1 Query: 178 CSEELFEM--IPASRFYHRTARHRS------RVHPYYLEPLR 279 CS F + P+S FY+R RH R HP+Y LR Sbjct: 1229 CSPSSFSLPCSPSSSFYYRVLRHHPFHYRVLRHHPFYYRVLR 1270 >SB_42286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1820 Score = 27.1 bits (57), Expect = 5.9 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = -2 Query: 218 KRDAGIISNNSSEHSPW-NIRYKIQREPKSLRRPRGSTWC*VVTGAH 81 +R GI ++ S +P+ + + + R L+RPR T +V GA+ Sbjct: 1729 QRSKGIGESHHSSEAPYAKVTHYVARHGSDLQRPRKETVSTIVAGAN 1775 >SB_11879| Best HMM Match : WD40 (HMM E-Value=5.8e-21) Length = 447 Score = 27.1 bits (57), Expect = 5.9 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +2 Query: 212 LVFTIAPPATGVEFIHTTWSHCGHPQCVSRDLFC 313 LV P TG+ TTW G PQ D+ C Sbjct: 32 LVIWQPDPDTGIWIETTTWHEIGRPQVHGYDMQC 65 >SB_7292| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1126 Score = 27.1 bits (57), Expect = 5.9 Identities = 23/101 (22%), Positives = 42/101 (41%), Gaps = 10/101 (9%) Frame = +1 Query: 127 RRDFGSLCILYRMFHG--ECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVRFQ 300 RR + + +++ +G + E F ++P +R H + R H + S + Sbjct: 1033 RRTLSRMSMFHQVVYGTVDIKREPF-LVPMNR--HSRNGNSKRFHRTH-----SKCNQHA 1084 Query: 301 RSFLPRTIRLWNELPSTV--------FPERYDMYFFKRGLW 399 SF P +I+ WN LP ++ F E+ + G W Sbjct: 1085 NSFFPWSIKFWNNLPGSITDIKEKGKFKEKLQQHLIDNGQW 1125 >SB_45340| Best HMM Match : RVT_1 (HMM E-Value=1.2e-15) Length = 447 Score = 27.1 bits (57), Expect = 5.9 Identities = 23/101 (22%), Positives = 42/101 (41%), Gaps = 10/101 (9%) Frame = +1 Query: 127 RRDFGSLCILYRMFHG--ECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVRFQ 300 RR + + +++ +G + E F ++P +R H + R H + S + Sbjct: 354 RRTLSRMSMFHQVVYGTVDIKREPF-LVPMNR--HSRNGNSKRFHRTH-----SKCNQHA 405 Query: 301 RSFLPRTIRLWNELPSTV--------FPERYDMYFFKRGLW 399 SF P +I+ WN LP ++ F E+ + G W Sbjct: 406 NSFFPWSIKFWNNLPGSITDIKEKGKFKEKLQQHLIDNGQW 446 >SB_26191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 27.1 bits (57), Expect = 5.9 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +1 Query: 253 HPYYLEPLRSSTVRFQRSFLPRTI-RLW 333 HPYY E + SS + F+ + + RTI R W Sbjct: 78 HPYYSERMLSSVLLFRENGIIRTIQREW 105 >SB_12216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2992 Score = 26.6 bits (56), Expect = 7.8 Identities = 10/28 (35%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = +2 Query: 212 LVFTIAPPATGVEFIHTTWSHCGHP-QC 292 +V+T+ PP +G +I + C P QC Sbjct: 144 VVYTLLPPLSGARYIRVVATECSPPGQC 171 >SB_2424| Best HMM Match : RVT_1 (HMM E-Value=6.2e-18) Length = 657 Score = 26.6 bits (56), Expect = 7.8 Identities = 24/97 (24%), Positives = 40/97 (41%), Gaps = 3/97 (3%) Frame = +1 Query: 115 PLGLRRDFGSLCILYRMFHGECSEELFEMIPA---SRFYHRTARHRSRVHPYYLEPLRSS 285 P+ R F L I ++ G + ++I +R+ R+ S +HP P + Sbjct: 554 PVRYRVKFKILLITFKALQGLAPRYITDLIRIKNNARYSLRSNEGLSLMHP----PGKMM 609 Query: 286 TVRFQRSFLPRTIRLWNELPSTVFPERYDMYFFKRGL 396 RSF LWN LP+ + +++FK L Sbjct: 610 KSFGDRSFSVAAPTLWNALPANLRTINCSIFYFKAQL 646 >SB_59146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 26.6 bits (56), Expect = 7.8 Identities = 18/61 (29%), Positives = 30/61 (49%) Frame = +1 Query: 196 EMIPASRFYHRTARHRSRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDM 375 EM+ R ++T R + + +YL+PL+ + + +T R LPS V E D+ Sbjct: 100 EMLAVLRKEYKTNRPKQVIPEFYLQPLKLFSRKDSEDDHRQTYRPGKGLPSKV--EYTDL 157 Query: 376 Y 378 Y Sbjct: 158 Y 158 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,673,560 Number of Sequences: 59808 Number of extensions: 370963 Number of successful extensions: 1395 Number of sequences better than 10.0: 103 Number of HSP's better than 10.0 without gapping: 1275 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1388 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 740151420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -