BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1039 (331 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 24 0.41 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 22 1.7 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 3.9 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 5.1 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 5.1 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 5.1 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 5.1 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 5.1 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 5.1 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 21 5.1 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 5.1 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 21 5.1 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 21 5.1 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 21 5.1 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 20 8.9 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 20 8.9 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 20 8.9 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 20 8.9 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 20 8.9 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 24.2 bits (50), Expect = 0.41 Identities = 12/52 (23%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +2 Query: 113 NSILTTNYCALIIPQIHFLTQFFALFYY-LLRWMNELTAHLVLMATGVHRHP 265 N+IL + C+L + HF ++ ++R + + A +V+++ G +P Sbjct: 280 NNILAASACSLFVVIFHFAHPREEFNHWTVMRCVQAMIAGIVVISAGADAYP 331 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 22.2 bits (45), Expect = 1.7 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -2 Query: 303 RAPPRGGWRHVRCGCLWTP 247 + P GWR +R WTP Sbjct: 212 KIPKSSGWRKLRNIVHWTP 230 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.0 bits (42), Expect = 3.9 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +2 Query: 254 HRHPQRTCRHPPRGGA 301 H P R C PPR G+ Sbjct: 1694 HCAPNRRCPPPPRMGS 1709 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 5.1 Identities = 8/30 (26%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = +2 Query: 197 LLRWMNELTAHLVLMATGVHR--HPQRTCR 280 +L NE+T H ++A + + + +TC+ Sbjct: 179 ILNKTNEITEHRTVLAVNIEKSENETKTCK 208 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 5.1 Identities = 8/30 (26%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = +2 Query: 197 LLRWMNELTAHLVLMATGVHR--HPQRTCR 280 +L NE+T H ++A + + + +TC+ Sbjct: 179 ILNKTNEITEHRTVLAVNIEKSENETKTCK 208 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 5.1 Identities = 8/30 (26%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = +2 Query: 197 LLRWMNELTAHLVLMATGVHR--HPQRTCR 280 +L NE+T H ++A + + + +TC+ Sbjct: 179 ILNKTNEITEHRTVLAVNIEKSENETKTCK 208 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 5.1 Identities = 8/30 (26%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = +2 Query: 197 LLRWMNELTAHLVLMATGVHR--HPQRTCR 280 +L NE+T H ++A + + + +TC+ Sbjct: 179 ILNKTNEITEHRTVLAVNIEKSENETKTCK 208 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 5.1 Identities = 8/30 (26%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = +2 Query: 197 LLRWMNELTAHLVLMATGVHR--HPQRTCR 280 +L NE+T H ++A + + + +TC+ Sbjct: 179 ILNKTNEITEHRTVLAVNIEKSENETKTCK 208 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 5.1 Identities = 8/30 (26%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = +2 Query: 197 LLRWMNELTAHLVLMATGVHR--HPQRTCR 280 +L NE+T H ++A + + + +TC+ Sbjct: 179 ILNKTNEITEHRTVLAVNIEKSENETKTCK 208 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 20.6 bits (41), Expect = 5.1 Identities = 8/30 (26%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = +2 Query: 197 LLRWMNELTAHLVLMATGVHR--HPQRTCR 280 +L NE+T H ++A + + + +TC+ Sbjct: 179 ILNKTNEITEHRTVLAVNIEKSENETKTCK 208 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 20.6 bits (41), Expect = 5.1 Identities = 8/30 (26%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = +2 Query: 197 LLRWMNELTAHLVLMATGVHR--HPQRTCR 280 +L NE+T H ++A + + + +TC+ Sbjct: 179 ILNKTNEITEHRTVLAVNIEKSENETKTCK 208 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.6 bits (41), Expect = 5.1 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 5 NLLHLGRSWGNIP 43 +LLHL SW N P Sbjct: 666 DLLHLFGSWSNRP 678 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.6 bits (41), Expect = 5.1 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 5 NLLHLGRSWGNIP 43 +LLHL SW N P Sbjct: 666 DLLHLFGSWSNRP 678 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.6 bits (41), Expect = 5.1 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 5 NLLHLGRSWGNIP 43 +LLHL SW N P Sbjct: 666 DLLHLFGSWSNRP 678 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 19.8 bits (39), Expect = 8.9 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -2 Query: 45 YGMLPHDLPK*SKL 4 YGM P D+ K S++ Sbjct: 397 YGMTPSDIDKYSRI 410 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 19.8 bits (39), Expect = 8.9 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -2 Query: 45 YGMLPHDLPK*SKL 4 YGM P D+ K S++ Sbjct: 397 YGMTPSDIDKYSRI 410 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 19.8 bits (39), Expect = 8.9 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -2 Query: 285 GWRHVRCGCLWTP 247 GWR +R WTP Sbjct: 133 GWRKLRNIVHWTP 145 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 19.8 bits (39), Expect = 8.9 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -2 Query: 285 GWRHVRCGCLWTP 247 GWR +R WTP Sbjct: 452 GWRKLRNIVHWTP 464 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 19.8 bits (39), Expect = 8.9 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -2 Query: 45 YGMLPHDLPK*SKL 4 YGM P D+ K S++ Sbjct: 335 YGMTPSDIDKYSRI 348 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,753 Number of Sequences: 438 Number of extensions: 1959 Number of successful extensions: 19 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 7342137 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -