BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1030 (740 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35352| Best HMM Match : zf-C2H2 (HMM E-Value=0.0016) 29 4.0 SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 >SB_35352| Best HMM Match : zf-C2H2 (HMM E-Value=0.0016) Length = 221 Score = 29.1 bits (62), Expect = 4.0 Identities = 18/80 (22%), Positives = 30/80 (37%) Frame = +1 Query: 10 FASSVRLSSVANLTASNSALVVTNRSAVVSCDILSST*SVRGTINAAGRIEVCLDNSMRR 189 F S R + L ASN V RS V D+ + G + +++ Sbjct: 64 FESRTRQNKPPPLLASNQVSVRAERSDVAMKDVAKCSQDGEGVVGPLKQLQQLAGGKASS 123 Query: 190 MGRWSRLELLSVINLPQTCN 249 + ++ V+NL + CN Sbjct: 124 TKKHQERQVAMVVNLSEVCN 143 >SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2211 Score = 28.7 bits (61), Expect = 5.2 Identities = 16/63 (25%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Frame = +1 Query: 19 SVRLSSVANLTASNSALVVTNRSAVVSCDILSST*-SVRGTINAAGRIEVCLDNSMRRMG 195 S+ AN + + + + N + S D L ++ +N + I + N+ RR+G Sbjct: 939 SIGYGKKANASVDSISRISINNQEIRSADSLKLLGVTIDSQLNFSEHISIACKNAGRRIG 998 Query: 196 RWS 204 RWS Sbjct: 999 RWS 1001 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,879,737 Number of Sequences: 59808 Number of extensions: 418103 Number of successful extensions: 919 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 853 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 919 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1998111622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -