BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1028 (761 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 24 1.2 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 2.7 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 22 4.6 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 21 8.1 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 8.1 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 8.1 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 8.1 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 8.1 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 24.2 bits (50), Expect = 1.2 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +2 Query: 29 LSYTISLFTLLLYISSFACVWWVPKNTP--KPNLTHG 133 L+Y LL YI S +W KN P KP L G Sbjct: 3 LAYIACFLLLLYYIYSKHYSYWQSKNVPTDKPFLFFG 39 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 138 VKGD*EPKPHQSQYNLG 188 V G EP PH S +N+G Sbjct: 72 VFGKVEPVPHTSSFNMG 88 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 22.2 bits (45), Expect = 4.6 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +2 Query: 185 RPQVNKSIPKEGCPQAGGY 241 RP++ + P + CP+ GY Sbjct: 95 RPKLQEPQPSQHCPRKHGY 113 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 21.4 bits (43), Expect = 8.1 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 512 IQQFQSKFSVAYFFIVAG 459 +QQ KF + Y FI G Sbjct: 358 VQQLAGKFLLNYIFIAVG 375 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.4 bits (43), Expect = 8.1 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +1 Query: 292 NCICLVPNSLPL 327 NCIC VP L L Sbjct: 202 NCICFVPGVLGL 213 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.4 bits (43), Expect = 8.1 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +1 Query: 292 NCICLVPNSLPL 327 NCIC VP L L Sbjct: 202 NCICFVPGVLGL 213 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.4 bits (43), Expect = 8.1 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +1 Query: 292 NCICLVPNSLPL 327 NCIC VP L L Sbjct: 202 NCICFVPGVLGL 213 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.4 bits (43), Expect = 8.1 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +1 Query: 292 NCICLVPNSLPL 327 NCIC VP L L Sbjct: 202 NCICFVPGVLGL 213 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,383 Number of Sequences: 336 Number of extensions: 3694 Number of successful extensions: 10 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20442493 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -