BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-1028 (761 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0643 - 21461123-21461902 29 3.1 06_03_0189 - 17697779-17698939 28 7.1 06_02_0035 + 10816723-10819497,10819964-10820011 28 9.3 >12_02_0643 - 21461123-21461902 Length = 259 Score = 29.5 bits (63), Expect = 3.1 Identities = 15/44 (34%), Positives = 18/44 (40%) Frame = +2 Query: 98 PKNTPKPNLTHGCRKRRLRAKASPKPIQPRPQVNKSIPKEGCPQ 229 P TP P R R + P P +PRP P GCP+ Sbjct: 200 PSRTPPPERRESPSPLRGRPRTPPPP-RPRPPTTPPRPYVGCPR 242 >06_03_0189 - 17697779-17698939 Length = 386 Score = 28.3 bits (60), Expect = 7.1 Identities = 21/95 (22%), Positives = 35/95 (36%), Gaps = 6/95 (6%) Frame = +2 Query: 35 YTISLFTLLLYISSFACVWWVPKNTPKPNLTHGCRKRRLR------AKASPKPIQPRPQV 196 Y S ++ S +C+ W+ + H CRK++ R A + P P + Sbjct: 164 YAASAIYIVSVCFSDSCIMWIRSLADDRGVRHACRKKQTRKEVVRVAASGPAPDLWAWRK 223 Query: 197 NKSIPKEGCPQAGGYKNVAKT*NTLSDASVKTTAF 301 P +G P GY + N + V+ F Sbjct: 224 YGQKPIKGSPYPRGYYRCSSNKNCAARKQVERCRF 258 >06_02_0035 + 10816723-10819497,10819964-10820011 Length = 940 Score = 27.9 bits (59), Expect = 9.3 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +2 Query: 35 YTISLF-TLLLYISSFACVWWVPKNTPKPNLTHGC 136 Y + L +LLYIS A + ++ K T THGC Sbjct: 336 YVLCLIGAVLLYISCLAVIKFLSKKTKPQAQTHGC 370 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,247,574 Number of Sequences: 37544 Number of extensions: 422945 Number of successful extensions: 991 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 960 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 988 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2039640244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -